Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: capte-ACHE1

Name Class
capte-ACHE1NameCapitella teleta (Capitella sp. I) polychaete worm Annelida acetylcholinesterase 1
SpeciesCapitella teleta
Gene_nameCAPTEDRAFT_182179
BlockC
FamilyACHE
DatabaseSwissProtR7U7Z4 R7U7Z4_CAPTE
GenbankEY627216
EY551148
KB304239
TremblR7U7Z4
NCBI_TaxID283909
PaperSimakov_2013_Nature_493_526
CommentCapitella teleta (Capitella sp. I) is a polychaete worm and a representative member of the phylum Annelida, also known as the segmented worms jgi|Capca1|182179|estExt_Genewise1Plus.C_350103 CAWW1998 CAWT18855 estExt_Genewise1Plus.C_350103 [Capca1:182179] T peptide KDMSEVEKEWKMQFHEWSTNYIVDWKIEFDRYKKRIESCPG H peptide NLTKKALDGRKCGRSEKERKPEVIEPEPLVPNITCASSKSAGFA VSAMDAMFLVFFVLLPPAAL
Proteincapte-ACHE1
Peptidecapte-ACHE1
Tree_nodeACHE23537
Cholinesterase161141

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer