Type : Fasciculin2 variant,Natural_modified,Peptide
Chemical_Nomenclature : TMCYSHTTTSRAILTNCGENSCYRKSWRHPPKMVLGRGCGCPPGDDNLEVKCCTSPDKCNY
Canonical SMILES :
InChI :
InChIKey :
Other name(s) :
MW : 7 kD
Formula :
CAS_number :
PubChem :
UniChem :
Families : R27W-fasciculin2 ligand of proteins in family
ACHE
Title : Expression and activity of mutants of fasciculin, a peptidic acetylcholinesterase inhibitor from mamba venom - Marchot_1997_J.Biol.Chem_272_3502 |
Author(s) : Marchot P , Prowse CN , Kanter J , Camp S , Ackermann EJ , Radic Z , Bougis PE , Taylor P |
Ref : Journal of Biological Chemistry , 272 :3502 , 1997 |
Abstract : Marchot_1997_J.Biol.Chem_272_3502 |
ESTHER : Marchot_1997_J.Biol.Chem_272_3502 |
PubMedSearch : Marchot_1997_J.Biol.Chem_272_3502 |
PubMedID: 9013597 |
Array ( [id] => 75 [inhibitor] => R27W-fasciculin2 [type] => Array ( [0] => Fasciculin2 variant [1] => Natural_modified [2] => Peptide ) [other_name] => Array ( ) [chemical_nomenclature] => TMCYSHTTTSRAILTNCGENSCYRKSWRHPPKMVLGRGCGCPPGDDNLEVKCCTSPDKCNY [formula] => [cas_number] => [mw] => 7 kD [pick_me_to_call] => display_script [kinetic_parameter] => [paper] => Marchot_1997_J.Biol.Chem_272_3502 [comment] => [gene_locus] => [kin_inhibitor] => R27W-fasciculin2 [cid] => [family] => ACHE [inchikey] => [canonicalsmiles] => [inchi] => [wikipedia] => [iupharlig] => [structure] => [substrate] => [interact_gene_locus] => [mutation] => [comment2] => [extoxnet] => [news] => [theoretical_model] => )