Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: zoone-a0a067rk64

Zootermopsis nevadensis (Dampwood termite). Uncharacterized protein

Relationship
Family|SERHL
Block| X
Position in NCBI Life Tree|Zootermopsis nevadensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Polyneoptera: N E > Dictyoptera: N E > Blattodea: N E > Blattoidea: N E > Termitoidae: N E > Termopsidae: N E > Termopsinae: N E > Termopsini: N E > Zootermopsis: N E > Zootermopsis nevadensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KK852575
1 UniProt : A0A067RK64
1 UniProt : A0A067RK64
1 Interpro : A0A067RK64
1 Pfam : A0A067RK64
1 PIRSF : A0A067RK64
1 SUPERFAM : A0A067RK64
Sequence
Graphical view for this peptide sequence: zoone-a0a067rk64
Colored MSA for SERHL (raw)
FTGKCWGSLNAKPVLCLHGYQDNAGTWDTLAPLLPHDISLLAVDLPGHGL
SSHIPTGNAYHLLDFVLAIQRIVNHYGWKKISLMGHSFGSISGFVYSALY
PEQVEHFIALDTIKRFNTDPARKLKNHGEILDKFLHLDSLDPKSSPSYIY
EDAVEHLHKSMEKCTTKGGCEILSRRGTIKMTDGSYSFSRDARLKASVDL
SYTWQYVLQFAANVKCKVLHIQALQGLTLEKPEEMDEFLDVLKKSAALYE
SHTVEGRHYVHLDFPERVAPIISDFLKQK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

FTGKCWGSLNAKPVLCLHGYQDNAGTWDTLAPLLPHDISLLAVDLPGHGL
SSHIPTGNAYHLLDFVLAIQRIVNHYGWKKISLMGHSFGSISGFVYSALY
PEQVEHFIALDTIKRFNTDPARKLKNHGEILDKFLHLDSLDPKSSPSYIY
EDAVEHLHKSMEKCTTKGGCEILSRRGTIKMTDGSYSFSRDARLKASVDL
SYTWQYVLQFAANVKCKVLHIQALQGLTLEKPEEMDEFLDVLKKSAALYE
SHTVEGRHYVHLDFPERVAPIISDFLKQK


Reference
    Title: Molecular traces of alternative social organization in a termite genome
    Terrapon N, Li C, Robertson HM, Ji L, Meng X, Booth W, Chen Z, Childers CP, Glastad KM and Liebig J <32 more author(s)>
    Ref: Nat Commun, 5:3636, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer