The lipase like protein: yeast-yfd4 Mil1(Yfl034w), specifically binds Apm2, one of the adaptor protein of (AP) complexes responsible for binding clathrin, cargo-sorting motifs, accessory factors, and membrane lipids. The paper by Whitfield et al. is the first description of a function for a member of the Duf_726 family. The same protein had been shown to interact with the ribosomal phosphoprotein P0 Aruna et al... yeast-yfd4 has a conserved catalytic triad only central part Pfam A DUF726 536 875
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Fungi: NE > Dikarya: NE > Ascomycota: NE > saccharomyceta: NE > Saccharomycotina: NE > Saccharomycetes: NE > Saccharomycetales: NE > Saccharomycetaceae: NE > Saccharomyces: NE > Saccharomyces cerevisiae: NE
6_AlphaBeta_hydrolase : yeast-SCYNR064CSaccharomycescerevisiae SCYNR064C, yeast-ynl5Saccharomyces cerevisiae (Baker's yeast) YNL115C hypothetical 74.0 kda protein in mls1-rpc19 intergenic region, yeast-YOR084W Saccharomyces cerevisiae (Baker's yeast) Peroxisomal membrane protein LPX1 chromosome xv reading frame orf yor084w, yeast-ymc0Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). Uncharacterized protein YML020W. A85-EsteraseD-FGH : yeast-yjg8 Saccharomyces cerevisiae (Baker's yeast)) S-formylglutathione hydrolase. ABHD11-Acetyl_transferase : yeast-yg1lSaccharomyces cerevisiae (Baker's yeast) IMO32 hypothetical 38.5 kda protein in erv1-gls2 intergenic region, yeast-yg19Saccharomyces cerevisiae (Baker's yeast) EAT1 YGR015C hypothetical 37.9 kda protein in msb2-uga1 intergenic region. ABHD13-BEM46 : yeast-yn60Saccharomyces cerevisiae (Baker's yeast) hypothetical 32.3 kda protein in kre1-hxt14 intergenic region. abh_upf0017 : yeast-MCFS1Saccharomyces cerevisiae (Baker's yeast) Acyl-coenzymeA:ethanol O-acyltransferase 51.7 kda sec62-msy1 intergenic region ypl095c, yeast-MCFS2Saccharomyces cerevisiae (Baker's yeast) EHT1, MCFS2, YBR177C, YBR1239 alcohol acyl transferase (octanoyl-CoA:ethanol acyltransferase also thioesterase), yeast-ym60Saccharomyces cerevisiae (Baker's yeast) monoacylglycerol lipase YMR210W 51.4 kda protein YM8261.04 in rar1-scj1 intergenic region. Acidic_Lipase : yeast-tgl1Saccharomyces cerevisiae (Baker's yeast) triglyceride lipase-cholesterol esterase (EC 3.1.1.-) Tgl1p, yeast-YLL012WSaccharomyces cerevisiae (Baker's yeast) chromosome xii yll012w Yeh1p Steryl ester hydrolase, yeast-YLR020CSaccharomyces cerevisiae (Baker's yeast) chromosome xii ylr020c Yeh2p. AlphaBeta_hydrolase : yeast-LDH1Saccharomyces cerevisiae (Yeast) Lipid droplet hydrolase 1 chromosome II reading frame ORF YBR204c, yeast-YDL057WSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl057w. Arb2_domain : yeast-hda1 Saccharomyces cerevisiae (Baker's yeast); Saccharomyces cerevisiae x Saccharomyces kudriavzevii . Histone deacetylase HDA1 (only c-term Arb2 domain). Carboxypeptidase_S10 : yeast-cbpy1 Saccharomyces cerevisiae Carboxypeptidase Y, vacuolar PRC1 gene encoding preproprotein carboxypeptidase Y (CPY), yeast-kex01 Saccharomyces cerevisiae, yeast Pheromone-processing carboxypeptidase KEX1, yeast-yby9Saccharomyces cerevisiae chromosome II reading frame ORF YBR139w. CGI-58_ABHD5_ABHD4 : yeast-cld1Saccharomyces cerevisiae (Baker's yeast) YGR110W hypothetical 52.0 kda protein in clb6-shy1 intergenic region, yeast-ECM18Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a; JAY291) hypothetical 53.2 kda extracellular matrix protein 18, yeast-ict1Saccharomyces cerevisiae (Baker's yeast) chromosome XII reading frame orf ylr099c Increased copper tolerance protein 1. Dienelactone_hydrolase : yeast-AIM2Saccharomyces cerevisiae (Baker's yeast) yae9 hypothetical 27.1 kda protein in acs1-gcv3 intergenic region, yeast-dlhhSaccharomyces cerevisiae (Baker's yeast) hydrolase) (dlh). DPP4N_Peptidase_S9 : yeast-dap1Saccharomyces cerevisiae (Baker's yeast) dipeptidyl aminopeptidase (STE13 or YCI1), yeast-dap2Saccharomyces cerevisiae (Baker's yeast) yhr028c gene for dipeptidyl aminopeptidase B (DPAP B). Duf_676 : yeast-ROG1Saccharomyces cerevisiae (Baker's yeast) Putative lipase ROG1 ygo4 78.1 kda protein in tip20-mrf1 intergenic region ygl144c, yeast-YDL109CSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl109c, yeast-YDR444WSaccharomyces cerevisiae (Baker's yeast) d9461.29p, yeast-yo059Saccharomyces cerevisiae (Baker's yeast) Putative lipase YOR059C LPL1 chromosome xv orf yor059c YOR29-10. FSH1 : yeast-FSH1 Saccharomyces cerevisiae (Baker's yeast); Saccharomyces arboricola; Saccharomyces eubayanus family of serine hydrolases 1 (EC 3.1.-.-) in aap1-smf2 intergenic region, yeast-FSH2Saccharomyces cerevisiae (Baker's yeast) hypothetical 24.5 kda protein in erg8-ubp8 intergenic region, yeast-FSH3Saccharomyces cerevisiae (Baker's yeast) hypothetical dihydrofolate reductase. Homoserine_transacetylase : yeast-met2Saccharomyces cerevisiae (Baker's yeast), Saccharomyces sp., Saccharomyces paradoxus, S. uvarum, S. bayanus, S. pastorianus, S carlsbergensis, S. bayanus x S. cerevisiae, Homoserine O-trans-acetylase. Kynurenine-formamidase : yeast-YDR428C Saccharomyces cerevisiae (Baker's yeast); Saccharomyces sp. Kynurenine formamidase KFA d9461.15p. LIDHydrolase : yeast-YPR147CSaccharomyces cerevisiae (Baker's yeast) YPR147cp lipid droplet associated enzyme triacylglycerol lipase and ester hydrolase. Lipase_3 : yeast-ATG15CDS from: Saccharomyces cerevisiae (and strain YJM789) lipase involved in lipid vesicles degradation YCR068W Cytoplasm to vacuole targeting protein 17 ATG15, yeast-yj77Saccharomyces cerevisiae chromosome X reading frame ORF YJR107w. LYsophospholipase_carboxylesterase : yeast-YLR118cSaccharomyces cerevisiae Ylr118c protein and gene in chromosome XII cosmid 9233. Monoglyceridelipase_lysophospholip : yeast-mgll Saccharomyces cerevisiae (Baker's yeast) MGLL Yju3p YKL094W YKL441 Monoglyceride lipase. PC-sterol_acyltransferase : yeast-pdatSaccharomyces cerevisiae (Baker's yeast) phospholipid:diacylglycerol acyltransferase (EC 2.3.1.158) (pdat) LRO1, yeast-yj68Saccharomyces cerevisiae (Baker's yeast) (and strain AWRI1631) hypothetical 74.1 kda protein in acr1-yuh1 intergenic region. PGAP1 : yeast-BST1Saccharomyces cerevisiae (Baker's yeast), BST1, YFL025C, GPI inositol-deacylase, yeast-tgl2Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; JAY291; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a) lipase 2 (EC 3.1.1.3) (triacylglycerol lipase). PPase_methylesterase_euk : yeast-ppme1Saccharomyces cerevisiae (Baker's yeast) protein phosphatase methylesterase 1 (EC 3.1.1.-) (pme-1) (yms2). Steryl_acetyl_hydrolase : yeast-SAY1Saccharomyces cerevisiae (Baker's yeast) hypothetical 48.5da prot YG5J chromosome VII. T6SS-TLE1 : yeasv-e7ltm5Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). YEL023C-like protein
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Saccharomyces cerevisiae S288c: N, E.
Saccharomyces cerevisiae YJM789: N, E.
Saccharomyces cerevisiae RM11-1a: N, E.
Saccharomyces cerevisiae AWRI1631: N, E.
Saccharomyces cerevisiae JAY291: N, E.
Saccharomyces cerevisiae EC1118: N, E.
Saccharomyces cerevisiae AWRI796: N, E.
Saccharomyces cerevisiae Lalvin QA23: N, E.
Saccharomyces cerevisiae Vin13: N, E.
Saccharomyces cerevisiae FostersO: N, E.
Saccharomyces cerevisiae FostersB: N, E.
Saccharomyces cerevisiae VL3: N, E.
Saccharomyces cerevisiae Kyokai no. 7: N, E.
Saccharomyces cerevisiae P301: N, E.
Saccharomyces cerevisiae R103: N, E.
Saccharomyces cerevisiae CEN.PK113-7D: N, E.
Saccharomyces cerevisiae R008: N, E.
Saccharomyces cerevisiae P283: N, E.
Saccharomyces cerevisiae YJM993: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MVGGSLVLGLSGGLLAPVIGGGIAAGLSTIGITGATSFLTGVGGTTVVAV SSTAIGANIGARGMSKRMGSVRTFEFRPLHNNRRVNLILTVSGWMVGNED DVRLPFSTVDPVEGDLYSLYWEPEMLKSIGQTVSIVATEIFTTSLQQILG ATVLTALISSIQWPMALSKLGYILDNPWNVSLDRAWSAGKILADTLIARN LGARPITLVGFSIGARVIFSCLIELCKKKALGLIENVYLFGTPAVMKKEQ LVMARSVVSGRFVNGYSDKDWFLAYLFRAAAGGFSAVMGISTIENVEGIE NINCTEFVDGHLNYRKSMPKLLKRIGIAV
The ribosomal phosphoprotein P0 of the human malarial parasite Plasmodium falciparum (PfP0) has been identified as a protective surface protein. In Drosophila, P0 protein functions in the nucleus. The ribosomal function of P0 is mediated at the stalk of the large ribosomal subunit at the GTPase centre, where the elongation factor eEF2 binds. The multiple roles of the P0 protein presumably occur through interactions with other proteins. To identify such interacting protein domains, a yeast two-hybrid screen was carried out. Out of a set of sixty clones isolated, twelve clones that interacted strongly with both PfP0 and the Saccharomyces cerevisiae P0 (ScP0) protein were analysed. These belonged to three broad classes: namely (i) ribosomal proteins; (ii) proteins involved in nucleotide binding; and (iii) hypothetical integral membrane proteins. One of the strongest interactors (clone 67B) mapped to the gene YFL034W which codes for a hypothetical integral membrane protein, and is conserved amongst several eukaryotic organisms. The insert of clone 67B was expressed as a recombinant protein, and immunoprecipitaion (IP) reaction with anti-P0 antibodies pulled down this protein along with PfP0 as well as ScP0 protein. Using deletion constructions, the domain of ScP0, which interacted with clone 67B, was mapped to 60-148 amino acids. It is envisaged that the surface localization of P0 protein may be mediated through interactions with putative YFL034W-like proteins in P. falciparum.
The availability of complete genomic sequences and technologies that allow comprehensive analysis of global expression profiles of messenger RNA have greatly expanded our ability to monitor the internal state of a cell. Yet biological systems ultimately need to be explained in terms of the activity, regulation and modification of proteins--and the ubiquitous occurrence of post-transcriptional regulation makes mRNA an imperfect proxy for such information. To facilitate global protein analyses, we have created a Saccharomyces cerevisiae fusion library where each open reading frame is tagged with a high-affinity epitope and expressed from its natural chromosomal location. Through immunodetection of the common tag, we obtain a census of proteins expressed during log-phase growth and measurements of their absolute levels. We find that about 80% of the proteome is expressed during normal growth conditions, and, using additional sequence information, we systematically identify misannotated genes. The abundance of proteins ranges from fewer than 50 to more than 10(6) molecules per cell. Many of these molecules, including essential proteins and most transcription factors, are present at levels that are not readily detectable by other proteomic techniques nor predictable by mRNA levels or codon bias measurements.
The complete nucleotide sequence of Saccharomyces cerevisiae chromosome VI (270 kb) has revealed that it contains 129 predicted or known genes (300 bp or longer). Thirty-seven (28%) of which have been identified previously. Among the 92 novel genes, 39 are highly homologous to previously identified genes. Local sequence motifs were compared to active ARS regions and inactive loci with perfect ARS core sequences to examine the relationship between these motifs and ARS activity. Additional ARS sequences were predominantly observed in 3' flanking sequences of active ARS loci.
Heterotetrameric adaptor protein complexes are important mediators of cargo protein sorting in clathrin-coated vesicles. The cell type-specific expression of alternate mu chains creates distinct forms of AP-1 with altered cargo sorting, but how these subunits confer differential function is unclear. Whereas some studies suggest the mu subunits specify localization to different cellular compartments, others find that the two forms of AP-1 are present in the same vesicle but recognize different cargo. Yeast have two forms of AP-1, which differ only in the mu chain. Here we show that the variant mu chain Apm2 confers distinct cargo-sorting functions. Loss of Apm2, but not of Apm1, increases cell surface levels of the v-SNARE Snc1. However, Apm2 is unable to replace Apm1 in sorting Chs3, which requires a dileucine motif recognized by the gamma/sigma subunits common to both complexes. Apm2 and Apm1 colocalize at Golgi/early endosomes, suggesting that they do not associate with distinct compartments. We identified a novel, conserved regulatory protein that is required for Apm2-dependent sorting events. Mil1 is a predicted lipase that binds Apm2 but not Apm1 and contributes to its membrane recruitment. Interactions with specific regulatory factors may provide a general mechanism to diversify the functional repertoire of clathrin adaptor complexes.
Protein phosphorylation is a post-translational modification widely used to regulate cellular responses. Recent studies showed that global phosphorylation analysis could be used to study signaling pathways and to identify targets of protein kinases in cells. A key objective of global phosphorylation analysis is to obtain an in-depth mapping of low abundance protein phosphorylation in cells; this necessitates the use of suitable separation techniques because of the complexity of the phosphoproteome. Here we developed a multidimensional chromatography technology, combining IMAC, hydrophilic interaction chromatography, and reverse phase LC, for phosphopeptide purification and fractionation. Its application to the yeast Saccharomyces cerevisiae after DNA damage led to the identification of 8764 unique phosphopeptides from 2278 phosphoproteins using tandem MS. Analysis of two low abundance proteins, Rad9 and Mrc1, revealed that approximately 50% of their phosphorylation was identified via this global phosphorylation analysis. Thus, this technology is suited for in-depth phosphoproteome studies.
Many industrial strains of Saccharomyces cerevisiae have been selected primarily for their ability to convert sugars into ethanol efficiently despite exposure to a variety of stresses. To begin investigation of the genetic basis of phenotypic variation in industrial strains of S. cerevisiae, we have sequenced the genome of a wine yeast, AWRI1631, and have compared this sequence with both the laboratory strain S288c and the human pathogenic isolate YJM789. AWRI1631 was found to be substantially different from S288c and YJM789, especially at the level of single-nucleotide polymorphisms, which were present, on average, every 150 bp between all three strains. In addition, there were major differences in the arrangement and number of Ty elements between the strains, as well as several regions of DNA that were specific to AWRI1631 and that were predicted to encode proteins that are unique to this industrial strain.
We sequenced the genome of Saccharomyces cerevisiae strain YJM789, which was derived from a yeast isolated from the lung of an AIDS patient with pneumonia. The strain is used for studies of fungal infections and quantitative genetics because of its extensive phenotypic differences to the laboratory reference strain, including growth at high temperature and deadly virulence in mouse models. Here we show that the approximately 12-Mb genome of YJM789 contains approximately 60,000 SNPs and approximately 6,000 indels with respect to the reference S288c genome, leading to protein polymorphisms with a few known cases of phenotypic changes. Several ORFs are found to be unique to YJM789, some of which might have been acquired through horizontal transfer. Localized regions of high polymorphism density are scattered over the genome, in some cases spanning multiple ORFs and in others concentrated within single genes. The sequence of YJM789 contains clues to pathogenicity and spurs the development of more powerful approaches to dissecting the genetic basis of complex hereditary traits.
        
Title: A global topology map of the Saccharomyces cerevisiae membrane proteome Kim H, Melen K, Osterberg M, von Heijne G Ref: Proc Natl Acad Sci U S A, 103:11142, 2006 : PubMed
The yeast Saccharomyces cerevisiae is, arguably, the best understood eukaryotic model organism, yet comparatively little is known about its membrane proteome. Here, we report the cloning and expression of 617 S. cerevisiae membrane proteins as fusions to a C-terminal topology reporter and present experimentally constrained topology models for 546 proteins. By homology, the experimental topology information can be extended to approximately 15,000 membrane proteins from 38 fully sequenced eukaryotic genomes.
The ribosomal phosphoprotein P0 of the human malarial parasite Plasmodium falciparum (PfP0) has been identified as a protective surface protein. In Drosophila, P0 protein functions in the nucleus. The ribosomal function of P0 is mediated at the stalk of the large ribosomal subunit at the GTPase centre, where the elongation factor eEF2 binds. The multiple roles of the P0 protein presumably occur through interactions with other proteins. To identify such interacting protein domains, a yeast two-hybrid screen was carried out. Out of a set of sixty clones isolated, twelve clones that interacted strongly with both PfP0 and the Saccharomyces cerevisiae P0 (ScP0) protein were analysed. These belonged to three broad classes: namely (i) ribosomal proteins; (ii) proteins involved in nucleotide binding; and (iii) hypothetical integral membrane proteins. One of the strongest interactors (clone 67B) mapped to the gene YFL034W which codes for a hypothetical integral membrane protein, and is conserved amongst several eukaryotic organisms. The insert of clone 67B was expressed as a recombinant protein, and immunoprecipitaion (IP) reaction with anti-P0 antibodies pulled down this protein along with PfP0 as well as ScP0 protein. Using deletion constructions, the domain of ScP0, which interacted with clone 67B, was mapped to 60-148 amino acids. It is envisaged that the surface localization of P0 protein may be mediated through interactions with putative YFL034W-like proteins in P. falciparum.
An analysis of the structurally and catalytically diverse serine hydrolase protein family in the Saccharomyces cerevisiae proteome was undertaken using two independent but complementary, large-scale approaches. The first approach is based on computational analysis of serine hydrolase active site structures; the second utilizes the chemical reactivity of the serine hydrolase active site in complex mixtures. These proteomics approaches share the ability to fractionate the complex proteome into functional subsets. Each method identified a significant number of sequences, but 15 proteins were identified by both methods. Eight of these were unannotated in the Saccharomyces Genome Database at the time of this study and are thus novel serine hydrolase identifications. Three of the previously uncharacterized proteins are members of a eukaryotic serine hydrolase family, designated as Fsh (family of serine hydrolase), identified here for the first time. OVCA2, a potential human tumor suppressor, and DYR-SCHPO, a dihydrofolate reductase from Schizosaccharomyces pombe, are members of this family. Comparing the combined results to results of other proteomic methods showed that only four of the 15 proteins were identified in a recent large-scale, "shotgun" proteomic analysis and eight were identified using a related, but similar, approach (neither identifies function). Only 10 of the 15 were annotated using alternate motif-based computational tools. The results demonstrate the precision derived from combining complementary, function-based approaches to extract biological information from complex proteomes. The chemical proteomics technology indicates that a functional protein is being expressed in the cell, while the computational proteomics technology adds details about the specific type of function and residue that is likely being labeled. The combination of synergistic methods facilitates analysis, enriches true positive results, and increases confidence in novel identifications. This work also highlights the risks inherent in annotation transfer and the use of scoring functions for determination of correct annotations.
The availability of complete genomic sequences and technologies that allow comprehensive analysis of global expression profiles of messenger RNA have greatly expanded our ability to monitor the internal state of a cell. Yet biological systems ultimately need to be explained in terms of the activity, regulation and modification of proteins--and the ubiquitous occurrence of post-transcriptional regulation makes mRNA an imperfect proxy for such information. To facilitate global protein analyses, we have created a Saccharomyces cerevisiae fusion library where each open reading frame is tagged with a high-affinity epitope and expressed from its natural chromosomal location. Through immunodetection of the common tag, we obtain a census of proteins expressed during log-phase growth and measurements of their absolute levels. We find that about 80% of the proteome is expressed during normal growth conditions, and, using additional sequence information, we systematically identify misannotated genes. The abundance of proteins ranges from fewer than 50 to more than 10(6) molecules per cell. Many of these molecules, including essential proteins and most transcription factors, are present at levels that are not readily detectable by other proteomic techniques nor predictable by mRNA levels or codon bias measurements.
The complete nucleotide sequence of Saccharomyces cerevisiae chromosome VI (270 kb) has revealed that it contains 129 predicted or known genes (300 bp or longer). Thirty-seven (28%) of which have been identified previously. Among the 92 novel genes, 39 are highly homologous to previously identified genes. Local sequence motifs were compared to active ARS regions and inactive loci with perfect ARS core sequences to examine the relationship between these motifs and ARS activity. Additional ARS sequences were predominantly observed in 3' flanking sequences of active ARS loci.