Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yarli-LIP8

Yarrowia lipolytica (Candida lipolytica) lipase (EC 3.1.1.3) (yllip8 protein) lipy8p

Comment
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Yarrowia lipolytica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Dipodascaceae: N E > Yarrowia: N E > Yarrowia lipolytica: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AJ549520, CR382128, DQ200800
>3 UniProt links 1 more: Q872L3, Q3HRV6, F2Z5Z7
>3 UniProt links 1 more: Q872L3, Q3HRV6, F2Z5Z7
>3 Interpro links 1 more: Q872L3, Q3HRV6, F2Z5Z7
>3 Pfam links 1 more: Q872L3, Q3HRV6, F2Z5Z7
>3 PIRSF links 1 more: Q872L3, Q3HRV6, F2Z5Z7
>3 SUPERFAM links 1 more: Q872L3, Q3HRV6, F2Z5Z7
Sequence
Graphical view for this peptide sequence: yarli-LIP8
Colored MSA for Lipase_3 (raw)
MVSLSARIKDFFSVLLLGAATITPSTQTAGVSQGFYDFARDFAHLSNIAY
CVNAPITPLNPDFTCGNSCKHFPEIELVKTFGGNFFKTSITGYLAVDHVK
KEKYVVFRGTFSLADAITDMQFQLSPFLVDVPALNTFSANDTTAEAQTHC
EGCKIHDGFSKAFTETWGNIGEDLQKHLDANPDYQLYVTGHSLGAAMALL
GATSIKLKGYDPILINYGQPRVGNKPFAEFINKLWFGEGNGLEITPERKL
YRMTHWNDIFVGLPNWEGYTHSNGEVYINNRFINPPLKDVISCAGGENSK
CYRSSFSLLSQINLLQNHLAYIDYIGYCALNIGRRELADQEHYTGPYYYG
HRSEEDFKKLGLELSTPQVEN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVSLSARIKDFFSVLLLGAATITPSTQTAGVSQGFYDFARDFAHLSNIAY
CVNAPITPLNPDFTCGNSCKHFPEIELVKTFGGNFFKTSITGYLAVDHVK
KEKYVVFRGTFSLADAITDMQFQLSPFLVDVPALNTFSANDTTAEAQTHC
EGCKIHDGFSKAFTETWGNIGEDLQKHLDANPDYQLYVTGHSLGAAMALL
GATSIKLKGYDPILINYGQPRVGNKPFAEFINKLWFGEGNGLEITPERKL
YRMTHWNDIFVGLPNWEGYTHSNGEVYINNRFINPPLKDVISCAGGENSK
CYRSSFSLLSQINLLQNHLAYIDYIGYCALNIGRRELADQEHYTGPYYYG
HRSEEDFKKLGLELSTPQVEN


References
3 more
    Title: Biochemical characterization of Yarrowia lipolytica LIP8, a secreted lipase with a cleavable C-terminal region
    Kamoun J, Schue M, Messaoud W, Baignol J, Point V, Mateos-Diaz E, Mansuelle P, Gargouri Y, Parsiegla G and Aloulou A <2 more author(s)>
    Ref: Biochimica & Biophysica Acta, 1851:129, 2015 : PubMed

            

    Title: Expression and purification of two lipases from Yarrowia lipolytica AS 2.1216
    Song HT, Jiang ZB, Ma LX
    Ref: Protein Expr Purif, 47:393, 2006 : PubMed

            

    Title: Genome evolution in yeasts
    Dujon B, Sherman D, Fischer G, Durrens P, Casaregola S, Lafontaine I, De Montigny J, Marck C, Neuveglise C and Souciet JL <57 more author(s)>
    Ref: Nature, 430:35, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer