Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanor-bioh

Xanthomonas oryzae pv. oryzae (and strains MAFF 311018; PXO99A) carboxylesterase bioh (EC 3.1.1.1) (biotin synthesis protein bioh)

Relationship
Family|BioH
Block| X
Position in NCBI Life Tree|Xanthomonas oryzae pv. oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas oryzae: N E > Xanthomonas oryzae pv. oryzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AE013598, AP008229, CP000967
2 UniProt : Q5H6D1, Q2P907
2 UniProt : Q5H6D1, Q2P907
2 Interpro : Q5H6D1, Q2P907
2 Pfam : Q5H6D1, Q2P907
2 PIRSF : Q5H6D1, Q2P907
2 SUPERFAM : Q5H6D1, Q2P907
Sequence
Graphical view for this peptide sequence: xanor-bioh
Colored MSA for BioH (raw)
MHIDVIGHGPALVLLHGWALHGGVFAPLVERLAPHYQLHLVDLPGHGFSR
DDSTPLALPYVVAEIAAATPPAVWLGWSLGGLFALHAAATLPQVRGLAMI
AATPRFVRGSDWPDAVQRELFVQFGTELSRDYRGTLERFLALDTLGSAHA
RSELRSLRETLTARGEPAPEALQQGLSLLERTDLRRALPQLARPSLWIAG
QRDRLVPAAGMHAAAALSPHAQALTIAGGGHAPFLGHADQVSEALQRFVA
SVP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHIDVIGHGPALVLLHGWALHGGVFAPLVERLAPHYQLHLVDLPGHGFSR
DDSTPLALPYVVAEIAAATPPAVWLGWSLGGLFALHAAATLPQVRGLAMI
AATPRFVRGSDWPDAVQRELFVQFGTELSRDYRGTLERFLALDTLGSAHA
RSELRSLRETLTARGEPAPEALQQGLSLLERTDLRRALPQLARPSLWIAG
QRDRLVPAAGMHAAAALSPHAQALTIAGGGHAPFLGHADQVSEALQRFVA
SVP


References
    Title: Genome sequence and rapid evolution of the rice pathogen Xanthomonas oryzae pv. oryzae PXO99A
    Salzberg SL, Sommer DD, Schatz MC, Phillippy AM, Rabinowicz PD, Tsuge S, Furutani A, Ochiai H, Delcher AL and Bogdanove AJ <27 more author(s)>
    Ref: BMC Genomics, 9:204, 2008 : PubMed

            

    Title: The genome sequence of Xanthomonas oryzae pathovar oryzae KACC10331, the bacterial blight pathogen of rice
    Lee BM, Park YJ, Park DS, Kang HW, Kim JG, Song ES, Park IC, Yoon UH, Hahn JH and Go SJ <9 more author(s)>
    Ref: Nucleic Acids Research, 33:577, 2005 : PubMed

            

    Title: Genome sequence of Xanthomonas oryzae pv. oryzae suggests contribution of large numbers of effector genes and insertion sequences to its race diversity
    Inoue Y, Takeya M, Sasaki A, Kaki H
    Ref: , 39:275, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer