Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vibha-1luxd

Vibrio harveyi, Vibrio orientalis, Vibrio vulnificus, Vibrio chagasii myristoyl-ACP-specific thioesterase acyl transferase (luxD) gene

Comment
Warning: the serine 77 in GXSXG motif is not the active site serine 114 as determined by X ray structure AASLS in Vibrio harveyi see Lawson_1994_Biochemistry_33_9382 Other strains: Vibrio harveyi (and strains ATCC BAA-1116 / BB120; HY01; Vibrio sp. BCB494) Vibrio orientalis (and strain CIP 102891) Vibrio vulnificus Vibrio chagasii IPR003157 Acyl_transf PF02273


Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Vibrio harveyi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Vibrio: N E > Vibrio harveyi group: N E > Vibrio harveyi: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1THT: Vibrio harveyi Myristoyl-ACP-specific thioesterase
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: vibha-1luxd
Colored MSA for Thioesterase_acyl-transferase (raw)
MNNQCKTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDH
FAGLAEYLSENGFHVFRYDSLHHVGLSSGSIDEFTMTTGKNSLCTVYHWL
QTKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALG
FDYLSLPIDELPNDLDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTS
VPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLGENLVVL
RNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIESR
TPEMA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNNQCKTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDH
FAGLAEYLSENGFHVFRYDSLHHVGLSSGSIDEFTMTTGKNSLCTVYHWL
QTKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALG
FDYLSLPIDELPNDLDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTS
VPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLGENLVVL
RNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIESR
TPEMA


References
2 more
    Title: Structure of a myristoyl-ACP-specific thioesterase from Vibrio harveyi
    Lawson DM, Derewenda U, Serre L, Ferri S, Szittner R, Wei Y, Meighen EA, Derewenda ZS
    Ref: Biochemistry, 33:9382, 1994 : PubMed

            

    Title: Organization of the lux structural genes of Vibrio harveyi. Expression under the T7 bacteriophage promoter, mRNA analysis, and nucleotide sequence of the luxD gene
    Miyamoto CM, Boylan M, Graham AF, Meighen EA
    Ref: Journal of Biological Chemistry, 263:13393, 1988 : PubMed

            

    Title: Nucleotide sequence of the luxA gene of Vibrio harveyi and the complete amino acid sequence of the alpha subunit of bacterial luciferase
    Cohn DH, Mileham AJ, Simon MI, Nealson KH, Rausch SK, Bonam D, Baldwin TO
    Ref: Journal of Biological Chemistry, 260:6139, 1985 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer