Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vibfu-c9pfx8

Vibrio furnissii Putative esterase

Comment
Other strains: Vibrio furnissii (strains: CIP 102972; DSM 14383 / NCTC 11218)


Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Vibrio furnissii CIP 102972
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Vibrio: N E > Vibrio furnissii: N E > Vibrio furnissii CIP 102972: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: vibfu-c9pfx8
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MKKILTTMAALWSLSSAQATPVNYAQLYQHHSSLLNEERQYSVYLPQEYS
AHPEQHFPVLYLLDGDQRLLQVAGIVHSFRSGLNPAIPAMIIVAIHNTDR
MRDYTPSHTDQLPNGDPAGPSYAHTGGGARFLQYLTQELRPEIERQFRTA
APNLLVGHSLGGLLALDAVARDQGAFQGYISIDASLWFDYPKNYQRIEHA
LITPLEHRASLYIAVANNPYTPGFGRSYVHRDHLNAFADNVSTHHAANLD
ITSRYYEHDDHHSVYHVAVYQGLQWLFRGYALDLAPGELKQAHVVANYQT
LNQRLSSQLTPDLGYLEMIIKKAKRWPQMAIDVKEAQAIQRHFTPPSAQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKILTTMAALWSLSSAQATPVNYAQLYQHHSSLLNEERQYSVYLPQEYS
AHPEQHFPVLYLLDGDQRLLQVAGIVHSFRSGLNPAIPAMIIVAIHNTDR
MRDYTPSHTDQLPNGDPAGPSYAHTGGGARFLQYLTQELRPEIERQFRTA
APNLLVGHSLGGLLALDAVARDQGAFQGYISIDASLWFDYPKNYQRIEHA
LITPLEHRASLYIAVANNPYTPGFGRSYVHRDHLNAFADNVSTHHAANLD
ITSRYYEHDDHHSVYHVAVYQGLQWLFRGYALDLAPGELKQAHVVANYQT
LNQRLSSQLTPDLGYLEMIIKKAKRWPQMAIDVKEAQAIQRHFTPPSAQ


Reference
    Title: Complete genome sequence of a free-living Vibrio furnissii sp. nov. strain (NCTC 11218)
    Lux TM, Lee R, Love J
    Ref: Journal of Bacteriology, 193:1487, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer