Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vibcl-q5ek34

Vibrio cholerae (strains bv. albensis; VL426; RC385) Vibrio sp. RC586 putative acyltransferase (fragment) luxD

Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Vibrio cholerae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Vibrio: N E > Vibrio cholerae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: AY876056, AB115761, EU122291
>3 UniProt links 2 more: Q5EK34, Q25QV4, B2XS46
>3 UniProt links 2 more: Q5EK34, Q25QV4, B2XS46
>3 Interpro links 2 more: Q5EK34, Q25QV4, B2XS46
>3 Pfam links 2 more: Q5EK34, Q25QV4, B2XS46
>3 PIRSF links 2 more: Q5EK34, Q25QV4, B2XS46
>3 SUPERFAM links 2 more: Q5EK34, Q25QV4, B2XS46
Sequence
Graphical view for this peptide sequence: vibcl-q5ek34
Colored MSA for Thioesterase_acyl-transferase (raw)
TIDHVISLSGNQQIHVWETPPTLKFNSMPTRRNSILIASGFARRMDHFAG
LARYLSANGFHVYRYDSLHHVGLSSGTIDQYTMSIGKQSLEIVMAWLHNR
GVTDIGVIAASLSARIAYASVNELDLSFLITAVGVVNLRDTLEKALGFDY
LSLPIQALPNDLDFEGHKLGAEVFVRDCFANHWDSFSSTVEQIRHLSIPF
IAFTANGDDWVKQDEVIEMLSHIPRGQSKLYSLLGSSHDLGENLVVLRNF
YQSVTKAAIALDSNSFDINIPFVEPTFEQLTIATVNERRMKNQIETETMM
QA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

TIDHVISLSGNQQIHVWETPPTLKFNSMPTRRNSILIASGFARRMDHFAG
LARYLSANGFHVYRYDSLHHVGLSSGTIDQYTMSIGKQSLEIVMAWLHNR
GVTDIGVIAASLSARIAYASVNELDLSFLITAVGVVNLRDTLEKALGFDY
LSLPIQALPNDLDFEGHKLGAEVFVRDCFANHWDSFSSTVEQIRHLSIPF
IAFTANGDDWVKQDEVIEMLSHIPRGQSKLYSLLGSSHDLGENLVVLRNF
YQSVTKAAIALDSNSFDINIPFVEPTFEQLTIATVNERRMKNQIETETMM
QA


References
    Title: Phylogenetic analysis of the incidence of lux gene horizontal transfer in Vibrionaceae
    Urbanczyk H, Ast JC, Kaeding AJ, Oliver JD, Dunlap PV
    Ref: Journal of Bacteriology, 190:3494, 2008 : PubMed

            

    Title: Freshwater bioluminescence in Vibrio albensis (Vibrio cholerae biovar albensis) NCIMB 41 is caused by a two-nucleotide deletion in luxO
    Kasai S
    Ref: J Biochem, 139:471, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer