Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tupch-l9l7d8.1

Tupaia chinensis (Chinese tree shrew). Pancreatic lipase

Comment
three genes concatened


Relationship
Family|Pancreatic_lipase
Block| L
Position in NCBI Life Tree|Tupaia chinensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Scandentia: N E > Tupaiidae: N E > Tupaia: N E > Tupaia chinensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KB320476
1 UniProt : L9L7D8
1 UniProt : L9L7D8
1 Interpro : L9L7D8
1 Pfam : L9L7D8
1 PIRSF : L9L7D8
1 SUPERFAM : L9L7D8
Sequence
Graphical view for this peptide sequence: tupch-l9l7d8.1
Colored MSA for Pancreatic_lipase (raw)
MLLLWILPLLLGAATGKEVCFPRLGCFSDDAPWAGIVERPLKILPWAPKD
VNTRFLLYTNENPDNFQEIVADPSTISDSNFNKDRKTRFIIHGFIDKGEE
NWLANMCKNLFQVESVNCICVDWKSGSRTGYTQASQNIRIVGAEVAYFVE
VLQSAFEYSPASVHIIGHSLGAHAAGEAGRRINGTIGRITGLDPAEPCFE
GTPELVRLDPSDAQFVDVIHTDGAPIIPNLGFGMSQSAGHLDFFPNGGIE
MPGCQKNILSQIVDIDGIWEGTRDFVACNHLRSYKYYTDSILNPDGFAGF
PCSSYSVFTANKCFPCPSEGCPQMGHYADRFPGKTAGEGQKFYLNTGDAS
NFARWRYQVAVTLSGRKVTGHVLVSLFGSKGNTKQYEIFKGTLRPDSTHS
NEFDSDVDVGDVQMVKFVWYNNVINPTLPRVGASKITVERNDGQVTAGDV
TQNCYVS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLLWILPLLLGAATGKEVCFPRLGCFSDDAPWAGIVERPLKILPWAPKD
VNTRFLLYTNENPDNFQEIVADPSTISDSNFNKDRKTRFIIHGFIDKGEE
NWLANMCKNLFQVESVNCICVDWKSGSRTGYTQASQNIRIVGAEVAYFVE
VLQSAFEYSPASVHIIGHSLGAHAAGEAGRRINGTIGRITGLDPAEPCFE
GTPELVRLDPSDAQFVDVIHTDGAPIIPNLGFGMSQSAGHLDFFPNGGIE
MPGCQKNILSQIVDIDGIWEGTRDFVACNHLRSYKYYTDSILNPDGFAGF
PCSSYSVFTANKCFPCPSEGCPQMGHYADRFPGKTAGEGQKFYLNTGDAS
NFARWRYQVAVTLSGRKVTGHVLVSLFGSKGNTKQYEIFKGTLRPDSTHS
NEFDSDVDVGDVQMVKFVWYNNVINPTLPRVGASKITVERNDGQVTAGDV
TQNCYVS


Reference
    Title: Genome of the Chinese tree shrew
    Fan Y, Huang ZY, Cao CC, Chen CS, Chen YX, Fan DD, He J, Hou HL, Hu L and Yao YG <23 more author(s)>
    Ref: Nat Commun, 4:1426, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer