Gene_locus Report for: tupch-l8y745

Tupaia chinensis (Chinese tree shrew). Monoglyceride lipase

Relationship

Family	\|	Monoglyceridelipase_lysophospholip
Block	\|	X
Position in NCBI Life Tree	\|	Tupaia chinensis

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Scandentia: N E > Tupaiidae: N E > Tupaia: N E > Tupaia chinensis: N E

There are 27 a/b hydrolases in Tupaia chinensis view in a: Table

ABHD6-Lip : tupch-l8y656Tupaia chinensis (Chinese tree shrew) Monoacylglycerol lipase ABHD6.
ABHD8 : tupch-l9kxg8Tupaia chinensis (Chinese tree shrew). Abhydrolase domain-containing protein 8.
ABHD11-Acetyl_transferase : tupch-l9kf47Tupaia chinensis (Chinese tree shrew). Abhydrolase domain-containing protein 11.
ABHD13-BEM46 : tupch-l9ja32Tupaia chinensis (Chinese tree shrew). Abhydrolase domain-containing protein 13.
ACHE : tupch-l9k1d4Tupaia chinensis (Chinese tree shrew) Acetylcholinesterase.
Arylacetamide_deacetylase : tupch-l9kr30Tupaia chinensis (Chinese tree shrew). Arylacetamide deacetylase, tupch-l9krr6Tupaia chinensis (Chinese tree shrew). Arylacetamide deacetylase.
Carb_B_Chordata : tupch-l9ktz3.1Tupaia chinensis (Chinese tree shrew) Carboxylesterase 5A, tupch-l9ktz3.2Tupaia chinensis (Chinese tree shrew) Carboxylesterase 5A, tupch-l9k2n0Tupaia chinensis (Chinese tree shrew) Cocaine esterase, tupch-l9k1w8Tupaia chinensis (Chinese tree shrew) Carboxylesterase 4A.
CIB-CCG1-interacting-factor-B : tupch-l8y5y7Tupaia chinensis (Chinese tree shrew). Abhydrolase domain-containing protein 14B.
CMBL : tupch-l9l5b1Tupaia chinensis (Chinese tree shrew). Carboxymethylenebutenolidase like protein.
Hepatic_Lipase : tupch-l9l8p0Tupaia chinensis (Chinese tree shrew). Hepatic triacylglycerol lipase.
Kynurenine-formamidase : tupch-l9kzp1Tupaia chinensis (Chinese tree shrew). N-formylkynurenine formamidase.
Lipoprotein_Lipase : tupch-l9jqg5Tupaia chinensis (Chinese tree shrew); Tupaia glis (Tree shrew) (Sorex glis). Lipoprotein lipase, tupch-l9l3m0Tupaia chinensis (Chinese tree shrew). Endothelial lipase.
Neuroligin : tupch-l9kz11Tupaia chinensis (Chinese tree shrew) Neuroligin-3.
Pancreatic_lipase : tupch-l9l7d8.1Tupaia chinensis (Chinese tree shrew). Pancreatic lipase, tupch-l9l7d8.2Tupaia chinensis (Chinese tree shrew). Pancreatic lipase, tupch-l9l7d8.3Tupaia chinensis (Chinese tree shrew). Pancreatic lipase.
PC-sterol_acyltransferase : tupch-lcatTupaia chinensis (Chinese tree shrew); Tupaia glis (Tree shrew) (Sorex glis). lecithin cholesterol acyltransferase.
Pectinacetylesterase-Notum : tupch-l9l458Tupaia chinensis (Chinese tree shrew). Protein notum like protein.
Phospholipase : tupch-l8y4e3Tupaia chinensis (Chinese tree shrew). Phospholipase A1 member A, tupch-l9khv5Tupaia chinensis (Chinese tree shrew). Lipase member I.
SERHL : tupch-l9knn8Tupaia chinensis (Chinese tree shrew). Serine hydrolase-like protein

Molecular evidence		Database
No mutation No structure No kinetic No Substrate No inhibitor		1 Genbank : KB368299 1 UniProt : L8Y745 1 UniProt : L8Y745 1 Interpro : L8Y745 1 Pfam : L8Y745 1 PIRSF : L8Y745 1 SUPERFAM : L8Y745

Sequence

Peptide

Graphical view for this peptide sequence: tupch-l8y745
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MPEGSSPRRTPQNVPYQDLPHLVNPDGQYLFCRYWKPAGTPKALVFVSHG AGEHCGRYAELAQMLVGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDV LQHVDTVQKDHPGLPVFLLGHSMGGAIAILTAVERPGHFSGMVLISPLVL TNPESATTFKDDLRTVRAVVGKASRTVFARIPRLFWVALYDADPLICRAG LKVCFGTQLLNAVSRVERAMPRLTAPLLLLQGSADRLCDSRGAHLLQEQE QDTEDPLPVLRCKVLAPTATRLPLAEPGLCPQIYEGAYHVLHKELPEVTS SVFQEISTWLSQRVGAAGARCPP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MPEGSSPRRTPQNVPYQDLPHLVNPDGQYLFCRYWKPAGTPKALVFVSHG
AGEHCGRYAELAQMLVGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDV
LQHVDTVQKDHPGLPVFLLGHSMGGAIAILTAVERPGHFSGMVLISPLVL
TNPESATTFKDDLRTVRAVVGKASRTVFARIPRLFWVALYDADPLICRAG
LKVCFGTQLLNAVSRVERAMPRLTAPLLLLQGSADRLCDSRGAHLLQEQE
QDTEDPLPVLRCKVLAPTATRLPLAEPGLCPQIYEGAYHVLHKELPEVTS
SVFQEISTWLSQRVGAAGARCPP

No Reference

Send your questions or comments to :Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.

For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

webmaster

Acknowledgements and disclaimer