Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tulge-tcea2

Tulipa gesneriana (Garden tulip). Tuliposide A-converting enzyme 2, chloroplastic

Comment
(from Uniprot) Lactone-forming carboxylesterases, specifically catalyzing intramolecular transesterification, but not hydrolysis. Involved in the biosynthesis of tulipalins, defensive chemicals that show antimicrobial activities against a broad range of strains of bacteria and fungi. Substrates are 6-tuliposide A > 6-tuliposide B. 6-tuliposide A and tuliposide A-converting enzyme, which are compartmentalized in the vacuoles and plastids respectively, come into contact with each other for the enzyme reaction releasing toxic tulipalin A upon cell disruption by pathogen infection or herbivore predation.


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Tulipa gesneriana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > Liliales: N E > Liliaceae: N E > Tulipa: N E > Tulipa gesneriana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
6-Tuliposide-A
No inhibitor
>3 Genbank links 1 more: AB569209, AB569210, AB569211
1 UniProt : I4DST9
>3 UniProt links 1 more: I4DST9, I4DSU0, I4DSU1
>3 Interpro links 1 more: I4DST9, I4DSU0, I4DSU1
>3 Pfam links 1 more: I4DST9, I4DSU0, I4DSU1
>3 PIRSF links 1 more: I4DST9, I4DSU0, I4DSU1
>3 SUPERFAM links 1 more: I4DST9, I4DSU0, I4DSU1
Sequence
Graphical view for this peptide sequence: tulge-tcea2
Colored MSA for Plant_carboxylesterase (raw)
MSVASFFSSLPARPFGYKDGRGRTGMVSTTDIGRRMVKPPVLACRPIESN
TYHGSVFLTKSSRSPSPSLSPTPTALDDEIVLDLKPFLIIYKSGRIERFL
GTTVIPACPEVATKDVVIDPATGVSVRLYLPNVVDLPSKKLPVLVYFHGG
GFVIENTGSPNYHNYLTLLAAKAGVLIVSINYRLAPEYPLPASYDDCMAG
FNWVVSHSAGPALEPWLAQHGDFSQILLSGDSAGGNVTHYVAMRADAGVI
EGVAIVHPYFLGSEPVGNEINDPANIEFHDKLWRLAAPDTEGLDDPLINP
VAPGAPILAGLKCKRAVVFVAGNDFLVERGRMYYEALVKSGWGGEAELVQ
HEGVGHVFHLSDYSGDISVAMMTKLIAFLKGE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSVASFFSSLPARPFGYKDGRGRTGMVSTTDIGRRMVKPPVLACRPIESN
TYHGSVFLTKSSRSPSPSLSPTPTALDDEIVLDLKPFLIIYKSGRIERFL
GTTVIPACPEVATKDVVIDPATGVSVRLYLPNVVDLPSKKLPVLVYFHGG
GFVIENTGSPNYHNYLTLLAAKAGVLIVSINYRLAPEYPLPASYDDCMAG
FNWVVSHSAGPALEPWLAQHGDFSQILLSGDSAGGNVTHYVAMRADAGVI
EGVAIVHPYFLGSEPVGNEINDPANIEFHDKLWRLAAPDTEGLDDPLINP
VAPGAPILAGLKCKRAVVFVAGNDFLVERGRMYYEALVKSGWGGEAELVQ
HEGVGHVFHLSDYSGDISVAMMTKLIAFLKGE


Reference
    Title: A novel lactone-forming carboxylesterase: molecular identification of a tuliposide A-converting enzyme in tulip
    Nomura T, Ogita S, Kato Y
    Ref: Plant Physiol, 159:565, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer