Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tubmm-d5g4w6

Tuber melanosporum (strain Mel28) (Perigord black truffle) Whole genome shotgun sequence assembly, scaffold_104, strain Mel28

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Tuber melanosporum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > Pezizomycetes: N E > Pezizales: N E > Tuberaceae: N E > Tuber: N E > Tuber melanosporum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FN429992
1 UniProt : D5G4W6
1 UniProt : D5G4W6
1 Interpro : D5G4W6
1 Pfam : D5G4W6
1 PIRSF : D5G4W6
1 SUPERFAM : D5G4W6
Sequence
Graphical view for this peptide sequence: tubmm-d5g4w6
Colored MSA for DPP4N_Peptidase_S9 (raw)
MKFSTALFFCLLGLLSISHAAPAPQGGSGSFTSRSTKRLPTLADALSGNF
SYEPASLRWIYAEGSEDGTYVAQDSSTLSLMRWDIRTNTSSIFVDIGELK
LPDYFNYSIQPSAKHVLFRTNFTTQYDHSYSADYYVWNVEAKTLVPLVEG
QNSDVQYAEWGPHGNVIVYVRGHDLFIWKDGVSTRVTNDGRESILTVFPF
FFYFGGESEMFSNWYTLCFSPDGEYLAYLRFNQTGVPTYNLPYYMGGEEV
APTYPEEHRIKYTKAGEKLPVVTFHLLEVKNPSVSRKIDLKTYTPDNMVI
TEVAWVAEKHERVIVRTQSRTQDTEKMVLVDVESGNTKVVRERNATDGWL
DEFRAIICELPFRDVPGLSTPSYLDISDHSGWTHIYLYPVAGGEPIALTS
GNWEVTTIYSVDTKRRLVYYQSTERDSTERHIFSVSLEGKTKKSLVDITK
EGYYDASFSPGGGYYILSYLGPNLPWQELRSISPDTPIRVINDNAPLKKK
LSEYALPKTSWSTLKHPDGYELNLFESLPPKFRKGVKYPVLFYIYGGPGS
QETGKTFRQTVDIYSYLGSDPELEYIVITVDNRGTGFKGRKFRSLVTGQL
GKLEAQDQVWAAREYAKRDYVDAKKIAIWGASYGGYLTGKVLELDSGAFS
LGIMAAPVTDWRFYNFMYSERYMKLPTTNSAGYNASAITKTAGFENVAGG
FIIQHGTGDDNVHFQNSAAFVDALVNEGVSPEKMRVQWFTDSDHYLYFHG
ATEFRHKQLAMALYDEKRRIPEGAHQWSRRGN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFSTALFFCLLGLLSISHAAPAPQGGSGSFTSRSTKRLPTLADALSGNF
SYEPASLRWIYAEGSEDGTYVAQDSSTLSLMRWDIRTNTSSIFVDIGELK
LPDYFNYSIQPSAKHVLFRTNFTTQYDHSYSADYYVWNVEAKTLVPLVEG
QNSDVQYAEWGPHGNVIVYVRGHDLFIWKDGVSTRVTNDGRESILTVFPF
FFYFGGESEMFSNWYTLCFSPDGEYLAYLRFNQTGVPTYNLPYYMGGEEV
APTYPEEHRIKYTKAGEKLPVVTFHLLEVKNPSVSRKIDLKTYTPDNMVI
TEVAWVAEKHERVIVRTQSRTQDTEKMVLVDVESGNTKVVRERNATDGWL
DEFRAIICELPFRDVPGLSTPSYLDISDHSGWTHIYLYPVAGGEPIALTS
GNWEVTTIYSVDTKRRLVYYQSTERDSTERHIFSVSLEGKTKKSLVDITK
EGYYDASFSPGGGYYILSYLGPNLPWQELRSISPDTPIRVINDNAPLKKK
LSEYALPKTSWSTLKHPDGYELNLFESLPPKFRKGVKYPVLFYIYGGPGS
QETGKTFRQTVDIYSYLGSDPELEYIVITVDNRGTGFKGRKFRSLVTGQL
GKLEAQDQVWAAREYAKRDYVDAKKIAIWGASYGGYLTGKVLELDSGAFS
LGIMAAPVTDWRFYNFMYSERYMKLPTTNSAGYNASAITKTAGFENVAGG
FIIQHGTGDDNVHFQNSAAFVDALVNEGVSPEKMRVQWFTDSDHYLYFHG
ATEFRHKQLAMALYDEKRRIPEGAHQWSRRGN


Reference
    Title: Perigord black truffle genome uncovers evolutionary origins and mechanisms of symbiosis
    Martin F, Kohler A, Murat C, Balestrini R, Coutinho PM, Jaillon O, Montanini B, Morin E, Noel B and Wincker P <41 more author(s)>
    Ref: Nature, 464:1033, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer