Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: torca-ACHE

Torpedo californica (Tetronarce californica) (Pacific electric ray) (Torpedo californica) acetylcholinesterase

Comment
Acetylcholinesterase (ACHE; EC 3.1.1.7) controls synaptic and neurohumoral cholinergic activity by hydrolyzing the neurotransmitter acetylcholine. ACHE function relies on precise regulation of its expression and localization. In particular, alternative splicing of the 3-prime region of ACHE results in ACHE isoforms with distinct C-terminal peptides that determine posttranslational maturation and oligomeric assembly Alternate Cterminus: T or H peptide


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Torpedo californica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Chondrichthyes: N E > Elasmobranchii: N E > Batoidea: N E > Torpediniformes: N E > Torpedinidae: N E > Tetronarce: N E > Tetronarce californica: N E


Molecular evidence
Database
20 mutations: Table (e.g. : C537D, C537G, C537S ... more)
125 structures (e.g. : 1ACJ, 1ACL, 1AMN... more)
Kinetic: torca-ACHE





3 substrates: Acetylcholine, Acetylthiocholine, N-Methylindoxyl-acetate
71 inhibitors (e.g. : (R)-Tacrine(10)-Hupyridone, (S,S)-(-)-bis(10)-hupyridone, (S,S)-(-)-bis(12)-hupyridone... more)
Sequence
Graphical view for this peptide sequence: torca-ACHE
Colored MSA for ACHE (raw)
DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEP
KKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIW
VPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRV
GAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGES
AGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELGR
NLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEF
FPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISRE
DFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGL
PLVKELNYTAEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQ
KFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATETIDEAERQWKTEFH
RWSSYMMHWKNQFDHYSRHESCAEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEP
KKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIW
VPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRV
GAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGES
AGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELGR
NLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEF
FPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISRE
DFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGL
PLVKELNYTAEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQ
KFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATETIDEAERQWKTEFH
RWSSYMMHWKNQFDHYSRHESCAEL


References
51 more
    Title: Torpedo californica acetylcholinesterase is stabilized by binding of a divalent metal ion to a novel and versatile 4D motif
    Silman I, Shnyrov VL, Ashani Y, Roth E, Nicolas A, Sussman JL, Weiner L
    Ref: Protein Science, 30:966, 2021 : PubMed

            

    Title: Rivastigmine and metabolite analogues with putative Alzheimer's disease-modifying properties in a Caenorhabditis elegans model.
    Dighe SN, De la Mora E, Chan S, Kantham S, McColl G, Miles JA, Veliyath SK, Sreenivas BY, Nassar ZD and Ross BP <6 more author(s)>
    Ref: Communications chemistry, 2:35, 2019 : PubMed

            

    Title: Primary structure of Torpedo californica acetylcholinesterase deduced from its cDNA sequence
    Schumacher M, Camp S, Maulet Y, Newton M, MacPhee-Quigley K, Taylor SS, Friedmann T, Taylor P
    Ref: Nature, 319:407, 1986 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer