Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tigja-ACHE2

Tigriopus japonicus (Copepod) acetylcholinesterase 2

Comment
Copepod


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Tigriopus japonicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Maxillopoda: N E > Copepoda: N E > Neocopepoda: N E > Podoplea: N E > Harpacticoida: N E > Harpacticidae: N E > Tigriopus: N E > Tigriopus japonicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KJ815006
1 Ncbi-nid : 699026338
1 Ncbi-pid : 699026339
1 UniProt : A0A0A0QWL0
1 Interpro : A0A0A0QWL0
1 Pfam : A0A0A0QWL0
1 PIRSF : A0A0A0QWL0
1 SUPERFAM : A0A0A0QWL0
Sequence
Graphical view for this peptide sequence: tigja-ACHE2
Colored MSA for ACHE (raw)
MAEDLKDRQSLVNLRDQMLKVLFAKDDDKLISGSKLMTQERRVNIQANNG
IIHGISDVIYPFTSKGDMMNAKTKRFLAIDDDDPELIKKVKQGTLKGINL
SRHVRAWLGVPYAQPPVGELRFAPPEDLEERDDDDTLETRSQPNSCMQNL
DTSGMTGAEMWNTKEELSEDCLYLNIYAPRNATELLPVLVWIHGGGHSTG
AASLDQYDGQQLVSSGNIVFVAIQYRLGPLGFMYLGERSGIPGNMGLLDQ
VKALDWISQNIQTFNGNPDEVTLMGESSGAHSVALHMISPKSEGLFQKAI
LHSSGLNPSWGYQAPKNALENARNLSSLLDCPEDPEDILTCLREKDAEEI
TSKAKEVLPKEAFLTFPFVVTLDGNFITEEPQEALANEVISSKIPVLLGS
NANEGFFDLLTNKPDTFPDKELDLRDMEMSEEDIEDQIKSLFPQYPAFIQ
RLIRHEYKDVISSSMAGKFHALDQIVGDSAYVCDTEHFAQAISENGNDVY
RFHFNHQSSQDPWPEYTGSKHGDEIEFIFGRPLENPNKYEVEELSLASDM
MTYWLNFVKTGNPNPSSLLASWPKYQEPCWPYLNLTAEFNGGKVFERTLN
GRCEFWNEILPSLLKELETDDKEEENQEAEAREFF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAEDLKDRQSLVNLRDQMLKVLFAKDDDKLISGSKLMTQERRVNIQANNG
IIHGISDVIYPFTSKGDMMNAKTKRFLAIDDDDPELIKKVKQGTLKGINL
SRHVRAWLGVPYAQPPVGELRFAPPEDLEERDDDDTLETRSQPNSCMQNL
DTSGMTGAEMWNTKEELSEDCLYLNIYAPRNATELLPVLVWIHGGGHSTG
AASLDQYDGQQLVSSGNIVFVAIQYRLGPLGFMYLGERSGIPGNMGLLDQ
VKALDWISQNIQTFNGNPDEVTLMGESSGAHSVALHMISPKSEGLFQKAI
LHSSGLNPSWGYQAPKNALENARNLSSLLDCPEDPEDILTCLREKDAEEI
TSKAKEVLPKEAFLTFPFVVTLDGNFITEEPQEALANEVISSKIPVLLGS
NANEGFFDLLTNKPDTFPDKELDLRDMEMSEEDIEDQIKSLFPQYPAFIQ
RLIRHEYKDVISSSMAGKFHALDQIVGDSAYVCDTEHFAQAISENGNDVY
RFHFNHQSSQDPWPEYTGSKHGDEIEFIFGRPLENPNKYEVEELSLASDM
MTYWLNFVKTGNPNPSSLLASWPKYQEPCWPYLNLTAEFNGGKVFERTLN
GRCEFWNEILPSLLKELETDDKEEENQEAEAREFF


Reference
    Title: Inhibitory effects of biocides on transcription and protein activity of acetylcholinesterase in the intertidal copepod Tigriopus japonicus
    Lee JW, Kim BM, Jeong CB, Won EJ, Rhee JS, Lee JS
    Ref: Comparative Biochemistry & Physiology C Pharmacol Toxicol, 167C:147, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer