Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tetng-q4sbm6

Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) hypothetical protein (fragment)

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Tetraodon nigroviridis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Eupercaria: N E > Tetraodontiformes: N E > Tetraodontoidei: N E > Tetradontoidea: N E > Tetraodontidae: N E > Tetraodon: N E > Tetraodon nigroviridis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CAAE01014667
1 UniProt : Q4SBM6
1 UniProt : Q4SBM6
1 Interpro : Q4SBM6
1 Pfam : Q4SBM6
1 PIRSF : Q4SBM6
1 SUPERFAM : Q4SBM6
Sequence
Graphical view for this peptide sequence: tetng-q4sbm6
Colored MSA for DPP4N_Peptidase_S9 (raw)
DSTEVVEMEDVPSQFFVQKHSWEGLRDIIHCSRKNSGIIANKAPHDFQFV
QKKDENGPHSHRLYYLGMPYGSRENSLLYSEIPKKVRKEALLVLSWKQML
DHFQATPHQGAYSREEELLRERKRLGAFGITSYDYHAQTGLFLFQASNSL
FYCQDGGQNSFIQSAPVKPVEIKTQCSGTRMDPKICPANPDFIAFINNND
LWVANIKTGEERRLTFCHKGADSVKEDPKSAGVATFVIQEEFDRFTGYWW
SPSAVEDPDGGKRVYLLYEEVDETEVEIIHVPSPALEERKADAYRYPRTG
SKNPQATIKLVEIKTDQQGRVSLCRLLCVFLLRSDDRAVLTCLYLQIVST
QDKELAVPFTSLFPGTEYIARVGWTSDGKYGWAALLDRSQRKLQLVLLPP
AFFVPVTDDPARRQESLEAVPDRTQPYVIYEETTDVWINVHDIFYPFVQT
AEDEFTFIWVNESKTGFSHLYKITSVLHPGFHCWAEAYHHTEGDPQRRIP
AVSTDVPPGDFKCAVKEEITLTSGEWEVLARHGSKIWVNESSKLVYFQGT
RDTPLEHHLYVVSYDSPGDVVRLTKPGFSHSCSVSQVKKSLQSDYFFNYS
SITLPLSLSSFIWQNFDFFVSHYSSVCTPPCVHVYKLNSSESDPLHIVPE
FWASMMESSGCPGDYSPPEIFDFQGKSGFQLYGMVYKPHSLQPGRKHPTV
LFVYGGPQVQLVNNSFKGMKYLRLNTLASLGYAVVVIDGRGSCQRGLEFE
SALKNKMGQVEIEDQVEGLQYVAEKFNFVDLSRVAIHGWSYGGFLSLMGL
IQRPNVFKLAIAGAPVTVWMAYDTGYTERYMDVPENNQQGYEEGSVALHV
DKLPSEPNRLLILHGFLDENVHFFHTNFLVSQIIRAGKPYQLQVYPNERH
SIRCPESGEHYEIMLLHFLQQYL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

DSTEVVEMEDVPSQFFVQKHSWEGLRDIIHCSRKNSGIIANKAPHDFQFV
QKKDENGPHSHRLYYLGMPYGSRENSLLYSEIPKKVRKEALLVLSWKQML
DHFQATPHQGAYSREEELLRERKRLGAFGITSYDYHAQTGLFLFQASNSL
FYCQDGGQNSFIQSAPVKPVEIKTQCSGTRMDPKICPANPDFIAFINNND
LWVANIKTGEERRLTFCHKGADSVKEDPKSAGVATFVIQEEFDRFTGYWW
SPSAVEDPDGGKRVYLLYEEVDETEVEIIHVPSPALEERKADAYRYPRTG
SKNPQATIKLVEIKTDQQGRVSLCRLLCVFLLRSDDRAVLTCLYLQIVST
QDKELAVPFTSLFPGTEYIARVGWTSDGKYGWAALLDRSQRKLQLVLLPP
AFFVPVTDDPARRQESLEAVPDRTQPYVIYEETTDVWINVHDIFYPFVQT
AEDEFTFIWVNESKTGFSHLYKITSVLHPGFHCWAEAYHHTEGDPQRRIP
AVSTDVPPGDFKCAVKEEITLTSGEWEVLARHGSKIWVNESSKLVYFQGT
RDTPLEHHLYVVSYDSPGDVVRLTKPGFSHSCSVSQVKKSLQSDYFFNYS
SITLPLSLSSFIWQNFDFFVSHYSSVCTPPCVHVYKLNSSESDPLHIVPE
FWASMMESSGCPGDYSPPEIFDFQGKSGFQLYGMVYKPHSLQPGRKHPTV
LFVYGGPQVQLVNNSFKGMKYLRLNTLASLGYAVVVIDGRGSCQRGLEFE
SALKNKMGQVEIEDQVEGLQYVAEKFNFVDLSRVAIHGWSYGGFLSLMGL
IQRPNVFKLAIAGAPVTVWMAYDTGYTERYMDVPENNQQGYEEGSVALHV
DKLPSEPNRLLILHGFLDENVHFFHTNFLVSQIIRAGKPYQLQVYPNERH
SIRCPESGEHYEIMLLHFLQQYL


Reference
    Title: Genome duplication in the teleost fish Tetraodon nigroviridis reveals the early vertebrate proto-karyotype
    Jaillon O, Aury JM, Brunet F, Petit JL, Stange-Thomann N, Mauceli E, Bouneau L, Fischer C, Ozouf-Costaz C and Roest Crollius H <51 more author(s)>
    Ref: Nature, 431:946, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer