Gene_locus Report for: tarsy-a0a1u7uhk2Tarsius syrichta (Philippine tarsier). mycophenolic acid acyl-glucuronide esterase, mitochondrial isoform X1 Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Tarsiiformes: N E > Tarsiidae: N E > Carlito: N E > Carlito syrichta: N E
ABHD13-BEM46 : tarsy-a0a1u7u649Tarsius syrichta (Philippine tarsier). protein ABHD13. ABHD16 : tarsy-a0a1u7u0w2Tarsius syrichta (Philippine tarsier). abhydrolase domain-containing protein 16A, tarsy-a0a1u7tjf4Tarsius syrichta (Philippine tarsier). abhydrolase domain-containing protein 16B. abh_upf0017 : tarsy-a0a1u7tah2Tarsius syrichta (Philippine tarsier). protein ABHD15. Arylacetamide_deacetylase : tarsy-a0a1u7t7n5Tarsius syrichta (Philippine tarsier). arylacetamide deacetylase-like 2, tarsy-a0a1u7tf59Tarsius syrichta (Philippine tarsier). arylacetamide deacetylase-like, tarsy-a0a1u7thd8Tarsius syrichta (Philippine tarsier). arylacetamide deacetylase, tarsy-a0a1u7uew0Tarsius syrichta (Philippine tarsier). arylacetamide deacetylase-like 2, tarsy-a0a1u7ui34Tarsius syrichta (Philippine tarsier). neutral cholesterol ester hydrolase 1. BCHE : tarsy-a0a1u7uyz0Tarsius syrichta (Philippine tarsier). Carboxylic ester hydrolase. Carb_B_Chordata : tarsy-a0a1u7slu1Tarsius syrichta (Philippine tarsier). Carboxylic ester hydrolase, tarsy-a0a1u7ssh7Tarsius syrichta (Philippine tarsier). Carboxylic ester hydrolase, tarsy-a0a1u7sxd9Tarsius syrichta (Philippine tarsier). Carboxylic ester hydrolase, tarsy-a0a1u7sz63Tarsius syrichta (Philippine tarsier). Carboxylic ester hydrolase, tarsy-a0a1u7t4r4Tarsius syrichta (Philippine tarsier). carboxylesterase 4A, tarsy-a0a1u7t7b8Tarsius syrichta (Philippine tarsier). Carboxylic ester hydrolase, tarsy-a0a1u7tai8Tarsius syrichta (Philippine tarsier). Carboxylic ester hydrolase. Cholesterol_esterase : tarsy-a0a1u7su80Tarsius syrichta (Philippine tarsier). Carboxylic ester hydrolase. CMBL : tarsy-a0a1u7v5h0Tarsius syrichta (Philippine tarsier). carboxymethylenebutenolidase homolog. Hepatic_Lipase : tarsy-a0a1u7sy37Tarsius syrichta (Philippine tarsier). hepatic triacylglycerol lipase. Lipoprotein_Lipase : tarsy-a0a1u7utu5Tarsius syrichta (Philippine tarsier). Lipoprotein lipase. Neuroligin : tarsy-a0a1u7szp2Tarsius syrichta (Philippine tarsier). neuroligin-3 isoform X1, tarsy-a0a1u7trt6Tarsius syrichta (Philippine tarsier). neuroligin-2. Pancreatic_lipase : tarsy-a0a1u7tph6Tarsius syrichta (Philippine tarsier). Pancreatic lipase, tarsy-a0a1u7u0f5Tarsius syrichta (Philippine tarsier). Pancreatic lipase, tarsy-a0a1u7ups3Tarsius syrichta (Philippine tarsier). Pancreatic lipase, tarsy-a0a1u7urb0Tarsius syrichta (Philippine tarsier). Pancreatic lipase. Phospholipase : tarsy-a0a1u7ssj2Tarsius syrichta (Philippine tarsier). phospholipase A1 member A-like, tarsy-a0a1u7u721Tarsius syrichta (Philippine tarsier). lipase member H isoform X1. Thyroglobulin : tarsy-a0a1u7tup6Tarsius syrichta (Philippine tarsier). thyroglobulin Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Carlito syrichta: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: tarsy-a0a1u7uhk2
Colored MSA for ABHD10 (raw)
MAGAGMAAVAAWGPCRSWGWAAVSSGSHHGLSALLARTPQRAPRCLPACR
QKTSLSFLNRPDLPNLAYKRLKGKSPGIIFIPGYLSNMNGTKALAIEEFC
KSLGHAYIRFDYSGVGSSDGNLQESTVGKWRKDVLSIIDDLAIGPQILVG
ASLGGWLMLHAAIARPEKVMALIGVATAVDGLVTQFNQLPVELKKEVEMK
GVWAMPSKYHEEGKYHIPYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
VVPWHTSMQVADRVLSKDVDIILRKHSDHRMKEKADIQLLVYTIDDLIDK
LSTIVN
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MAGAGMAAVAAWGPCRSWGWAAVSSGSHHGLSALLARTPQRAPRCLPACR
QKTSLSFLNRPDLPNLAYKRLKGKSPGIIFIPGYLSNMNGTKALAIEEFC
KSLGHAYIRFDYSGVGSSDGNLQESTVGKWRKDVLSIIDDLAIGPQILVG
ASLGGWLMLHAAIARPEKVMALIGVATAVDGLVTQFNQLPVELKKEVEMK
GVWAMPSKYHEEGKYHIPYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
VVPWHTSMQVADRVLSKDVDIILRKHSDHRMKEKADIQLLVYTIDDLIDK
LSTIVN
|
|
|
|
