Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strsu-q673u2

Streptococcus suis, dipeptidyl aminopeptidase IV

Comment
Other strains: Streptococcus suis (89/1591; 98HAH33; P1/7; GZ1; 89/1591; JS14; BM407; SC84; 05ZYH33)


Relationship
Family|Lactobacillus_peptidase
Block| X
Position in NCBI Life Tree|Streptococcus suis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus suis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AY533504, AAFA02000002
3 UniProt : Q673U2, D5AFN4, A4VSS6
3 UniProt : Q673U2, D5AFN4, A4VSS6
3 Interpro : Q673U2, D5AFN4, A4VSS6
3 Pfam : Q673U2, D5AFN4, A4VSS6
3 PIRSF : Q673U2, D5AFN4, A4VSS6
3 SUPERFAM : Q673U2, D5AFN4, A4VSS6
Sequence
Graphical view for this peptide sequence: strsu-q673u2
Colored MSA for Lactobacillus_peptidase (raw)
MRFNQFSFIKKETSVYLQELDTLGFQLIPDASSKTNLETFVRKCHFLTAN
TDFALSNMIAEWDTDLLTFFQSDRELTDQIFYQVAFQLLGFVPGMDYTDV
MDFVEKSNFPIVYGDIIDNLYQLLNTRTKSGNTLIDQLVSDDLIPEDNHY
HFFNGKSMATFSTKNLIREVVYVETPVDTAGTGQTDIVKLSILRPHFDGK
IPAVITNSPYHQGVNDVASDKALHKMEGELAEKQVGTIQVKQASITKLDL
DQRNLPVSPATEKLGHITSYSLNDYFLARGFASLHVSGVGTLGSTGYMTS
GDYQQVEGYKAVIDWLNGRTKAYTDHTRSLEVKADWANGKVATTGLSYLG
TMSNALATTGVDGLEVIIAEAGISSWYDYYRENGLVTSPGGYPGEDLDSL
TALTYSKSLQAGDFLRNKAAYEKGLAAERAALDRTSGDYNQYWHDRNYLL
HADRVKCEVVFTHGSQDWNVKPIHVWNMFHALPSHIKKHLFFHNGAHVYM
NNWQSIDFRESMNALLSQKLLGYENNYQLPTVIWQDNSGEQTWTTLDTFG
GENETVLPLGTGSQTVANQYTQEDFERYGKSYSAFHQDLYAGKANQISIE
LPVTEGLLLNGQVTLKLRVASSVAKGLLSAQLLDKGNKKRLAPIPAPKAR
LSLDNGRYHAQENLVELPYVEMPQRLVTKGFMNLQNRTDLMTVEEVVPGQ
WMNLTWKLQPTIYQLKKGDVLELILYTTDFECTVRDNSQWQIHLDLSQSQ
LILPH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRFNQFSFIKKETSVYLQELDTLGFQLIPDASSKTNLETFVRKCHFLTAN
TDFALSNMIAEWDTDLLTFFQSDRELTDQIFYQVAFQLLGFVPGMDYTDV
MDFVEKSNFPIVYGDIIDNLYQLLNTRTKSGNTLIDQLVSDDLIPEDNHY
HFFNGKSMATFSTKNLIREVVYVETPVDTAGTGQTDIVKLSILRPHFDGK
IPAVITNSPYHQGVNDVASDKALHKMEGELAEKQVGTIQVKQASITKLDL
DQRNLPVSPATEKLGHITSYSLNDYFLARGFASLHVSGVGTLGSTGYMTS
GDYQQVEGYKAVIDWLNGRTKAYTDHTRSLEVKADWANGKVATTGLSYLG
TMSNALATTGVDGLEVIIAEAGISSWYDYYRENGLVTSPGGYPGEDLDSL
TALTYSKSLQAGDFLRNKAAYEKGLAAERAALDRTSGDYNQYWHDRNYLL
HADRVKCEVVFTHGSQDWNVKPIHVWNMFHALPSHIKKHLFFHNGAHVYM
NNWQSIDFRESMNALLSQKLLGYENNYQLPTVIWQDNSGEQTWTTLDTFG
GENETVLPLGTGSQTVANQYTQEDFERYGKSYSAFHQDLYAGKANQISIE
LPVTEGLLLNGQVTLKLRVASSVAKGLLSAQLLDKGNKKRLAPIPAPKAR
LSLDNGRYHAQENLVELPYVEMPQRLVTKGFMNLQNRTDLMTVEEVVPGQ
WMNLTWKLQPTIYQLKKGDVLELILYTTDFECTVRDNSQWQIHLDLSQSQ
LILPH


References
    Title: Complete genome sequence of Streptococcus suis serotype 14 strain JS14
    Hu P, Yang M, Zhang A, Wu J, Chen B, Hua Y, Yu J, Xiao J, Jin M
    Ref: Journal of Bacteriology, 193:2375, 2011 : PubMed

            

    Title: Clinical, experimental, and genomic differences between intermediately pathogenic, highly pathogenic, and epidemic Streptococcus suis
    Ye C, Zheng H, Zhang J, Jing H, Wang L, Xiong Y, Wang W, Zhou Z, Sun Q and Xu J <3 more author(s)>
    Ref: J Infect Dis, 199:97, 2009 : PubMed

            

    Title: Cloning, purification, and enzymatic properties of dipeptidyl peptidase IV from the swine pathogen Streptococcus suis
    Jobin MC, Martinez G, Motard J, Gottschalk M, Grenier D
    Ref: Journal of Bacteriology, 187:795, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer