Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strmn-c6spx6

Streptococcus mutans serotype c (strain NN2025) Putative uncharacterized protein

Comment
Other strains: Streptococcus mutans serotype c (strain NN2025)


Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Streptococcus mutans serotype c
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus mutans: N E > Streptococcus mutans serotype C: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: strmn-c6spx6
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MHFERRSHWSGQLGREMYFNVYGHAGKPIIVFPSSGGSQNEYGDFGMIEA
CQSFINRGLVKFYTPDSLDRESWLAEGKSGHDMALAHEAYDRYIVHELVS
LIRYESNWNGMMMATGCSMGAFHTVNFSLRHPDLFDISVALSGVYDARFF
TGEFYGDPAVYYNSPIDYLWNQEDSWFLDRYRRNRFIVAVGQGAWEEPHI
IDTIRLEEAFEAKSIPAWFDFWGSDVAHDWEWWRVQMPYFLGKLEEEGRI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHFERRSHWSGQLGREMYFNVYGHAGKPIIVFPSSGGSQNEYGDFGMIEA
CQSFINRGLVKFYTPDSLDRESWLAEGKSGHDMALAHEAYDRYIVHELVS
LIRYESNWNGMMMATGCSMGAFHTVNFSLRHPDLFDISVALSGVYDARFF
TGEFYGDPAVYYNSPIDYLWNQEDSWFLDRYRRNRFIVAVGQGAWEEPHI
IDTIRLEEAFEAKSIPAWFDFWGSDVAHDWEWWRVQMPYFLGKLEEEGRI


Reference
    Title: Comparative genomic analyses of Streptococcus mutans provide insights into chromosomal shuffling and species-specific content
    Maruyama F, Kobata M, Kurokawa K, Nishida K, Sakurai A, Nakano K, Nomura R, Kawabata S, Ooshima T and Nakagawa I <3 more author(s)>
    Ref: BMC Genomics, 10:358, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer