Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strgg-b1vzw6

Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) Putative uncharacterized protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Streptomyces griseus subsp. griseus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces griseus group: N E > Streptomyces griseus subgroup: N E > Streptomyces griseus: N E > Streptomyces griseus subsp. griseus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: strgg-b1vzw6
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MDRILSADGTPIAYRRQGDGPPLVLVGGALSASAADAPLAALLAPRFTVL
TYDRRGRGASGEAGRWSAAREVEDLTAVVGAAGAGASVFGMAAGGALALE
AVAAGLPVELLAVYEPPYTPGASGLLFKARCTARLHRLLAAGDRGGAVDL
FLSMTGVAEETAARMRRTALWAELEAMAHTLAYDDALLGDGAVPVERFAA
VAARTLVICGGFSSPPARAATRTLAEALPRGRHRTLTGQMREVAPQVIAP
VLAEFFAKDAYVYRQAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDRILSADGTPIAYRRQGDGPPLVLVGGALSASAADAPLAALLAPRFTVL
TYDRRGRGASGEAGRWSAAREVEDLTAVVGAAGAGASVFGMAAGGALALE
AVAAGLPVELLAVYEPPYTPGASGLLFKARCTARLHRLLAAGDRGGAVDL
FLSMTGVAEETAARMRRTALWAELEAMAHTLAYDDALLGDGAVPVERFAA
VAARTLVICGGFSSPPARAATRTLAEALPRGRHRTLTGQMREVAPQVIAP
VLAEFFAKDAYVYRQAS


References
    Title: Draft genome sequence of marine Streptomyces sp. strain W007, which produces angucyclinone antibiotics with a benz[a]anthracene skeleton
    Qin S, Zhang H, Li F, Zhu B, Zheng H
    Ref: Journal of Bacteriology, 194:1628, 2012 : PubMed

            

    Title: Genome sequence of Streptomyces griseus strain XylebKG-1, an ambrosia beetle-associated actinomycete
    Grubbs KJ, Biedermann PH, Suen G, Adams SM, Moeller JA, Klassen JL, Goodwin LA, Woyke T, Munk AC and Currie CR <4 more author(s)>
    Ref: Journal of Bacteriology, 193:2890, 2011 : PubMed

            

    Title: Genome sequence of the streptomycin-producing microorganism Streptomyces griseus IFO 13350
    Ohnishi Y, Ishikawa J, Hara H, Suzuki H, Ikenoya M, Ikeda H, Yamashita A, Hattori M, Horinouchi S
    Ref: Journal of Bacteriology, 190:4050, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer