Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strau-brpa1

Streptomyces aureofaciens bromoperoxidase BPO-A1 (bpoA1)

Relationship
Family|Haloperoxidase
Block| X
Position in NCBI Life Tree|Streptomyces aureofaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Kitasatospora: N E > Kitasatospora aureofaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1A8Q: Streptomyces aureofaciens Bromoperoxidase A1
No kinetic





No Substrate
No inhibitor
1 Genbank : U01096
1 UniProt : P33912
1 Ncbi-nid : 522149
1 Ncbi-pid : 522150
1 Structure : 1A8Q
1 UniProt : P33912
1 Interpro : P33912
1 Pfam : P33912
1 PIRSF : P33912
1 SUPERFAM : P33912
Sequence
Graphical view for this peptide sequence: strau-brpa1
Colored MSA for Haloperoxidase (raw)
MPICTTRDGVEIFYKDWGQGRPVVFIHGWPLNGDAWQDQLKAVVDAGYRG
IAHDRRGHGHSTPVWDGYDFDTFADDLNDLLTDLDLRDVTLVAHSMGGGE
LARYVGRHGTGRLRSAVLLSAIPPVMIKSDKNPDGVPDEVFDALKNGVLT
ERSQFWKDTAEGFFSANRPGNKVTQGNKDAFWYMAMAQTIEGGVRCVDAF
GYTDFTEDLKKFDIPTLVVHGDDDQVVPIDATGRKSAQIIPNAELKVYEG
SSHGIAMVPGDKEKFNRDLLEFLNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPICTTRDGVEIFYKDWGQGRPVVFIHGWPLNGDAWQDQLKAVVDAGYRG
IAHDRRGHGHSTPVWDGYDFDTFADDLNDLLTDLDLRDVTLVAHSMGGGE
LARYVGRHGTGRLRSAVLLSAIPPVMIKSDKNPDGVPDEVFDALKNGVLT
ERSQFWKDTAEGFFSANRPGNKVTQGNKDAFWYMAMAQTIEGGVRCVDAF
GYTDFTEDLKKFDIPTLVVHGDDDQVVPIDATGRKSAQIIPNAELKVYEG
SSHGIAMVPGDKEKFNRDLLEFLNK


References
    Title: Random mutagenesis and selection of organic solvent-stable haloperoxidase from Streptomyces aureofaciens
    Yamada R, Higo T, Yoshikawa C, China H, Yasuda M, Ogino H
    Ref: Biotechnol Prog, 31:917, 2015 : PubMed

            

    Title: Cloning of a second non-haem bromoperoxidase gene from Streptomyces aureofaciens ATCC 10762: sequence analysis, expression in Streptomyces lividans and enzyme purification
    Pelletier I, Pfeifer O, Altenbuchner J, van Pee KH
    Ref: Microbiology, 140:509, 1994 : PubMed

            

    Title: Purification, characterization and comparison of two non-haem bromoperoxidases from Streptomyces aureofaciens ATCC 10762
    Weng M, Pfeifer O, Krauss S, Lingens F, van Pee KH
    Ref: J Gen Microbiol, 137:2539, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer