Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: serl9-f8pc39

Serpula lacrymans var. lacrymans (strains S7.9; S7.3) (Dry rot fungus) Putative uncharacterized protein

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Serpula lacrymans var. lacrymans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Boletales: N E > Coniophorineae: N E > Serpulaceae: N E > Serpula: N E > Serpula lacrymans: N E > Serpula lacrymans var. lacrymans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : GL945444, GL945490
2 UniProt : F8PC39, F8QCK7
2 UniProt : F8PC39, F8QCK7
2 Interpro : F8PC39, F8QCK7
2 Pfam : F8PC39, F8QCK7
2 PIRSF : F8PC39, F8QCK7
2 SUPERFAM : F8PC39, F8QCK7
Sequence
Graphical view for this peptide sequence: serl9-f8pc39
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MVAATPLSQKSPPSVKLDAAIFTGTTNGSVSAFLGIPYVQPPVGDLRFHL
PQAIPAYNGTYNASAYGPSCPQQTFKVPGNLTAETEAILASLVADGSPQS
EDCLTINIFTPAGATSNSNLPVAVVRGFAVGAASRYPGGVIVNRSLELNE
PVIYVSLNYRVTIQSIYLGFGFLGGQEVMDAGVANLGLHDQRQALRWVQK
YISSFGGDPSKEVFIFSWGESAGSTSIAYHMITNGGDNEGLFRAAFMQSG
SQLPVSGMKGGQPYYDTVVKAAGCSNSSDTLQCLREAPYDTLKSAIDNVP
TFYDYQALVLAWMPRPDGVFLVDNPQTLIQQGIVANVPFVNGDCDDEATP
FSYSTLNITTEQELREYITTYWSPHASNSTLDKLMELYPVTPADGSPFNT
GNNNTMTPQFKRIAAFLGDINFQGPRRLLLQARSGHRNVWSFVNKRLKDL
PGLDINMVYGPADMTDYLVRFVANLDPSGNTGIDWPQYKTETPNLLTFLD
GSIPANITQDTYRKEGIEFVTQMMLDDPWQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVAATPLSQKSPPSVKLDAAIFTGTTNGSVSAFLGIPYVQPPVGDLRFHL
PQAIPAYNGTYNASAYGPSCPQQTFKVPGNLTAETEAILASLVADGSPQS
EDCLTINIFTPAGATSNSNLPVAVVRGFAVGAASRYPGGVIVNRSLELNE
PVIYVSLNYRVTIQSIYLGFGFLGGQEVMDAGVANLGLHDQRQALRWVQK
YISSFGGDPSKEVFIFSWGESAGSTSIAYHMITNGGDNEGLFRAAFMQSG
SQLPVSGMKGGQPYYDTVVKAAGCSNSSDTLQCLREAPYDTLKSAIDNVP
TFYDYQALVLAWMPRPDGVFLVDNPQTLIQQGIVANVPFVNGDCDDEATP
FSYSTLNITTEQELREYITTYWSPHASNSTLDKLMELYPVTPADGSPFNT
GNNNTMTPQFKRIAAFLGDINFQGPRRLLLQARSGHRNVWSFVNKRLKDL
PGLDINMVYGPADMTDYLVRFVANLDPSGNTGIDWPQYKTETPNLLTFLD
GSIPANITQDTYRKEGIEFVTQMMLDDPWQ


Reference
    Title: The plant cell wall-decomposing machinery underlies the functional diversity of forest fungi
    Eastwood DC, Floudas D, Binder M, Majcherczyk A, Schneider P, Aerts A, Asiegbu FO, Baker SE, Barry K and Watkinson SC <38 more author(s)>
    Ref: Science, 333:762, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer