Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schma-g4v9h7

Schistosoma mansoni (Blood fluke, platyhelminth) Putative uncharacterized protein

Relationship
Family|OtherNon-catalytic_C
Block| C
Position in NCBI Life Tree|Schistosoma mansoni
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Trematoda: N E > Digenea: N E > Strigeidida: N E > Schistosomatoidea: N E > Schistosomatidae: N E > Schistosoma: N E > Schistosoma mansoni: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: schma-g4v9h7
Colored MSA for OtherNon-catalytic_C (raw)
MTVIVIIFALSYFGIWFNNSQPNVVNIFCGKIKGIQKDDYTISYLGIPYA
LPPINENRFRPPVHLSSKKLCHKAWELSNTTVINSIYYTQYYKPSCLQLL
PKSLENAFDGSENCLYLNIHVPINRKSINQAKPVIIIIDGLFFMYSNEPK
QPSSDTVYKTDAIHVTFNFRLGPFGFLPHPYEKIPNLGLHDQLLVLQWIR
NNIAQFGGDPFNVILFGYGSGATCALTLFYSSISNQLFDKLWITAPSLSL
LNRSVNDSIQTMNYALNCHNHINPNNCSNEKLNNFKNILNIWNWTIIEKW
LIHSMFSLPSINELNNNHDKINNFINILINDNKFINIDLWNKMINSNNNN
HNNNKPMIIGQTSHEVSIYPIPKTIPFWNKNHYQNYIIKKLKINNITLND
QYYQYIFSNNLNCTHIDGNIENKIINESNDWMSNLMLLITDSRLTCPLSE
LVNQLTNQYYPIYQYYLTGIHRRFDPYSLNSYISYAFHGWDAMLYLRTYE
IHNDFIDPSLLQLNNQYNNEKELNQLRRISDLLNKAMYEFARTGYISNWY
ESKKGNYDVNLIENDQLCKYVNIMNERCSFWKLLYNNNLFQSTWKF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTVIVIIFALSYFGIWFNNSQPNVVNIFCGKIKGIQKDDYTISYLGIPYA
LPPINENRFRPPVHLSSKKLCHKAWELSNTTVINSIYYTQYYKPSCLQLL
PKSLENAFDGSENCLYLNIHVPINRKSINQAKPVIIIIDGLFFMYSNEPK
QPSSDTVYKTDAIHVTFNFRLGPFGFLPHPYEKIPNLGLHDQLLVLQWIR
NNIAQFGGDPFNVILFGYGSGATCALTLFYSSISNQLFDKLWITAPSLSL
LNRSVNDSIQTMNYALNCHNHINPNNCSNEKLNNFKNILNIWNWTIIEKW
LIHSMFSLPSINELNNNHDKINNFINILINDNKFINIDLWNKMINSNNNN
HNNNKPMIIGQTSHEVSIYPIPKTIPFWNKNHYQNYIIKKLKINNITLND
QYYQYIFSNNLNCTHIDGNIENKIINESNDWMSNLMLLITDSRLTCPLSE
LVNQLTNQYYPIYQYYLTGIHRRFDPYSLNSYISYAFHGWDAMLYLRTYE
IHNDFIDPSLLQLNNQYNNEKELNQLRRISDLLNKAMYEFARTGYISNWY
ESKKGNYDVNLIENDQLCKYVNIMNERCSFWKLLYNNNLFQSTWKF


Reference
    Title: The genome of the blood fluke Schistosoma mansoni
    Berriman M, Haas BJ, LoVerde PT, Wilson RA, Dillon GP, Cerqueira GC, Mashiyama ST, Al-Lazikani B, Andrade LF and El-Sayed NM <46 more author(s)>
    Ref: Nature, 460:352, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer