Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhime-R01391

Rhizobium meliloti (Sinorhizobium meliloti) Rhizobium sp. (strain NGR234) 3.1.2.12

Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Sinorhizobium meliloti
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Sinorhizobium/Ensifer group: N E > Sinorhizobium: N E > Sinorhizobium meliloti: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL591787, CP001389, CP000874
3 UniProt : Q92QE0, C3MB14, C3KKJ9
3 UniProt : Q92QE0, C3MB14, C3KKJ9
3 Interpro : Q92QE0, C3MB14, C3KKJ9
3 Pfam : Q92QE0, C3MB14, C3KKJ9
3 PIRSF : Q92QE0, C3MB14, C3KKJ9
3 SUPERFAM : Q92QE0, C3MB14, C3KKJ9
Sequence
Graphical view for this peptide sequence: rhime-R01391
Colored MSA for A85-EsteraseD-FGH (raw)
MKVISQNTAFGGMQGVYAHDSTACKGEMTFAVFVPPQAITEPRPVLWYLS
GLTCTHANVMEKGEYRRMASELGLIIVCPDTSPRGADVPDELTNWQMGKG
AGFYLDATEKPWAEHYRMYSYITEELPALVGQHFRVDMGRQGIFGHSMGG
HGAMTVALKHPERFKSCSAFAPIVAPSSADWSVGAFEKYLGPDKAAWREY
DACALVEDGARFPEFLIDQGKADSFLENGLRPWLFEEAVKGTDIGLTLRM
HERYDHSYYFISTFMDDHLRWHAERLG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVISQNTAFGGMQGVYAHDSTACKGEMTFAVFVPPQAITEPRPVLWYLS
GLTCTHANVMEKGEYRRMASELGLIIVCPDTSPRGADVPDELTNWQMGKG
AGFYLDATEKPWAEHYRMYSYITEELPALVGQHFRVDMGRQGIFGHSMGG
HGAMTVALKHPERFKSCSAFAPIVAPSSADWSVGAFEKYLGPDKAAWREY
DACALVEDGARFPEFLIDQGKADSFLENGLRPWLFEEAVKGTDIGLTLRM
HERYDHSYYFISTFMDDHLRWHAERLG


References
1 more
    Title: Rhizobium sp. strain NGR234 possesses a remarkable number of secretion systems
    Schmeisser C, Liesegang H, Krysciak D, Bakkou N, Le Quere A, Wollherr A, Heinemeyer I, Morgenstern B, Pommerening-Roser A and Streit WR <8 more author(s)>
    Ref: Applied Environmental Microbiology, 75:4035, 2009 : PubMed

            

    Title: An evolutionary hot spot: the pNGR234b replicon of Rhizobium sp. strain NGR234
    Streit WR, Schmitz RA, Perret X, Staehelin C, Deakin WJ, Raasch C, Liesegang H, Broughton WJ
    Ref: Journal of Bacteriology, 186:535, 2004 : PubMed

            

    Title: Analysis of the chromosome sequence of the legume symbiont Sinorhizobium meliloti strain 1021
    Capela D, Barloy-Hubler F, Gouzy J, Bothe G, Ampe F, Batut J, Boistard P, Becker A, Boutry M and Galibert F <18 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 98:9877, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer