Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhifr-i3xe25

Sinorhizobium fredii USDA 257. Virulence factor family protein

Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Sinorhizobium fredii USDA 257
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Sinorhizobium/Ensifer group: N E > Sinorhizobium: N E > Sinorhizobium fredii group: N E > Sinorhizobium fredii: N E > Sinorhizobium fredii USDA 257: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP003563
1 UniProt : I3XE25
1 UniProt : I3XE25
1 Interpro : I3XE25
1 Pfam : I3XE25
1 PIRSF : I3XE25
1 SUPERFAM : I3XE25
Sequence
Graphical view for this peptide sequence: rhifr-i3xe25
Colored MSA for VirJ (raw)
MIRMTRIWKGAALATLIAAAASLPSAAEEARFDTGMIPSPHILFPKQDAS
GLVVLLSGADGWTEKEDAVARSLSGENALVVGIDLKAYLAALAKDDGECI
YTVSDIESLSQQVQRAAASGAYRPPVVAGVGAGGAMALAIAAQSPAATIG
KTLAVDPEEGIALTRQLCTPAEKTRKGDRLVYGLTDGPLPDPVSVTFSPA
ASAEGRQHVAALVDKHPDIETTDTEDDAYAALSGALSEYLQEGDETDNPF
GLPLTVLDAKPSRDTVAVIYSGDGGWRDIDKEVGNALQQQGVPVVGIDSL
RYFWSERQPQATADDLARIISYYRKRWNVRNVLLVGYSFGADILPRTYNL
LPAATRARVRQVTLMAMSHRADFKISVLGWFGAEGEASAGDPVDDVRAID
PSLVQCIYGTEEEDDACPGLKSSGVDVVAIEGGHHFDEDYPALTRRVLDA
LDRRLAAK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIRMTRIWKGAALATLIAAAASLPSAAEEARFDTGMIPSPHILFPKQDAS
GLVVLLSGADGWTEKEDAVARSLSGENALVVGIDLKAYLAALAKDDGECI
YTVSDIESLSQQVQRAAASGAYRPPVVAGVGAGGAMALAIAAQSPAATIG
KTLAVDPEEGIALTRQLCTPAEKTRKGDRLVYGLTDGPLPDPVSVTFSPA
ASAEGRQHVAALVDKHPDIETTDTEDDAYAALSGALSEYLQEGDETDNPF
GLPLTVLDAKPSRDTVAVIYSGDGGWRDIDKEVGNALQQQGVPVVGIDSL
RYFWSERQPQATADDLARIISYYRKRWNVRNVLLVGYSFGADILPRTYNL
LPAATRARVRQVTLMAMSHRADFKISVLGWFGAEGEASAGDPVDDVRAID
PSLVQCIYGTEEEDDACPGLKSSGVDVVAIEGGHHFDEDYPALTRRVLDA
LDRRLAAK


Reference
    Title: Complete genome sequence of the broad-host-range strain Sinorhizobium fredii USDA257
    Schuldes J, Rodriguez Orbegoso M, Schmeisser C, Krishnan HB, Daniel R, Streit WR
    Ref: Journal of Bacteriology, 194:4483, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer