Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psepy-prxc

Burkholderia pyrrocinia chloroperoxidase gene

Comment
previously called P.pyorocivia Previously called Pseudomonas pyrrocinia


Relationship
Family|Haloperoxidase
Block| X
Position in NCBI Life Tree|Burkholderia pyrrocinia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia pyrrocinia: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : M60743
1 UniProt : P25026
1 Ncbi-nid : 151185
1 Ncbi-pid : 151186
1 UniProt : P25026
1 Interpro : P25026
1 Pfam : P25026
1 PIRSF : P25026
1 SUPERFAM : P25026
Sequence
Graphical view for this peptide sequence: psepy-prxc
Colored MSA for Haloperoxidase (raw)
MPYVTTKDNVEIFYKDWGPKDAQPIVFHHGWPLSGDDWDAQMLFFVQKGY
RVIAHDRRGHGRSAQVSDGHDMDHYAADAFAVVEALDLRNAVHIGHSTGG
GEVARYVANDGQPAGRVAKAVLVSAVPPLMLKTESNPEGLPIEVFDGFRK
ALADNRAQFFLDVPTGPFYGFNRAGATVHQGVIRNWWRQGMEGSAKAHYD
GIKAFSETDQTEDLKSITVPTLVLHGEDDQIVPIADAALKSIKLLQNGTL
KTYPGYSHGMLTVNADVLNADLLAFVQA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPYVTTKDNVEIFYKDWGPKDAQPIVFHHGWPLSGDDWDAQMLFFVQKGY
RVIAHDRRGHGRSAQVSDGHDMDHYAADAFAVVEALDLRNAVHIGHSTGG
GEVARYVANDGQPAGRVAKAVLVSAVPPLMLKTESNPEGLPIEVFDGFRK
ALADNRAQFFLDVPTGPFYGFNRAGATVHQGVIRNWWRQGMEGSAKAHYD
GIKAFSETDQTEDLKSITVPTLVLHGEDDQIVPIADAALKSIKLLQNGTL
KTYPGYSHGMLTVNADVLNADLLAFVQA


Reference
    Title: Chloroperoxidase-encoding gene from Pseudomonas pyrrocinia: sequence, expression in heterologous hosts, and purification of the enzyme
    Wolfframm C, Lingens F, Mutzel R, van Pee KH
    Ref: Gene, 130:131, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer