Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psepu-oxoH

Pseudomonas putida 2-oxo-1,2-dihydroquinoline 8-monooxygenase oxoH gene

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Pseudomonas putida
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas putida group: N E > Pseudomonas putida: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : Y12655, AJ583091
1 UniProt : Q70FG4
1 Ncbi-nid : 2072730
1 Ncbi-pid : 2072733
2 UniProt : Q70FG4, O05936
2 Interpro : Q70FG4, O05936
2 Pfam : Q70FG4, O05936
2 PIRSF : Q70FG4, O05936
2 SUPERFAM : Q70FG4, O05936
Sequence
Graphical view for this peptide sequence: psepu-oxoH
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MSQTPDSRFVSVDGVRLHYYEIDGPDERPPVIFTHGGGPGSSGWSNFRLS
AVAFSARYRCYFLDFPQFGQSDMVPVDGPVFSWHARKLLGFMDALGIRQA
HLVNQSFGGCVAIRFAADHPERVATLQLIASQPVERGITQPLPLFSKHAA
TLMSDYYLADGGPSPAKMAALIRRYELHDDHRLDEENLRLRYEASANPGF
LKLLDIPGAFGQWENLLPVFSRVVAPTQVFWGLHDWFGGVDVPMLMLNQF
ADARLYVMGKAAHHVQTECPDEF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSQTPDSRFVSVDGVRLHYYEIDGPDERPPVIFTHGGGPGSSGWSNFRLS
AVAFSARYRCYFLDFPQFGQSDMVPVDGPVFSWHARKLLGFMDALGIRQA
HLVNQSFGGCVAIRFAADHPERVATLQLIASQPVERGITQPLPLFSKHAA
TLMSDYYLADGGPSPAKMAALIRRYELHDDHRLDEENLRLRYEASANPGF
LKLLDIPGAFGQWENLLPVFSRVVAPTQVFWGLHDWFGGVDVPMLMLNQF
ADARLYVMGKAAHHVQTECPDEF


References
    Title: Sequence and transcriptional analysis of a gene cluster of Pseudomonas putida 86 involved in quinoline degradation
    Carl B, Arnold A, Hauer B, Fetzner S
    Ref: Gene, 331:177, 2004 : PubMed

            

    Title: 2-oxo-1,2-dihydroquinoline 8-monooxygenase: phylogenetic relationship to other multicomponent nonheme iron oxygenases
    Rosche B, Tshisuaka B, Hauer B, Lingens F, Fetzner S
    Ref: Journal of Bacteriology, 179:3549, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer