Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psefl-este

Pseudomonas fluorescens SIK WI (and strain SBW25) esterase PFEI

Relationship
Family|Haloperoxidase
Block| X
Position in NCBI Life Tree|Pseudomonas fluorescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas fluorescens group: N E > Pseudomonas fluorescens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
6 structures (e.g. : 1VA4, 3HEA, 3HI4... more)
No kinetic





1 substrate:
2-azabicyclo[2.2.1]hept-5-en-3-one
1 inhbitor:
(2R)-butane-2-sulfonate
3 Genbank : U12537, AM181176, WP_120448209
3 UniProt : P22862, C3K9A2, A0A386Y9C1
1 Ncbi-nid : 951088
1 Ncbi-pid : 951089
>3 Structure links 3 more: 3T4U, 3T52, 3IA2
3 UniProt : P22862, C3K9A2, A0A386Y9C1
3 Interpro : P22862, C3K9A2, A0A386Y9C1
3 Pfam : P22862, C3K9A2, A0A386Y9C1
3 PIRSF : P22862, C3K9A2, A0A386Y9C1
3 SUPERFAM : P22862, C3K9A2, A0A386Y9C1
Sequence
Graphical view for this peptide sequence: psefl-este
Colored MSA for Haloperoxidase (raw)
MSTFVAKDGTQIYFKDWGSGKPVLFSHGWLLDADMWEYQMEYLSSRGYRT
IAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGD
VARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLK
DRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFA
ETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDA
PHGFAVTHAQQLNEDLLAFLKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTFVAKDGTQIYFKDWGSGKPVLFSHGWLLDADMWEYQMEYLSSRGYRT
IAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGD
VARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLK
DRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFA
ETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDA
PHGFAVTHAQQLNEDLLAFLKR


References
12 more
    Title: AsiteDesign: a Semirational Algorithm for an Automated Enzyme Design
    Roda S, Terholsen H, Meyer JRH, Canellas-Sole A, Guallar V, Bornscheuer U, Kazemi M
    Ref: J Phys Chem B, :, 2023 : PubMed

            

    Title: New structural motif for carboxylic acid perhydrolases
    Yin DT, Purpero VM, Fujii R, Jing Q, Kazlauskas RJ
    Ref: Chemistry, 19:3037, 2013 : PubMed

            

    Title: Structure of an aryl esterase from Pseudomonas fluorescens
    Cheeseman JD, Tocilj A, Park S, Schrag JD, Kazlauskas RJ
    Ref: Acta Crystallographica D Biol Crystallogr, 60:1237, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer