Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseae-PA2949

Pseudomonas aeruginosa, Pseudomonas sp. esterase (probable lipase)

Comment
Other strains Pseudomonas aeruginosa 18A; 39016,PA45; PADK2_CF510; CI27; NCGM2.S1; VRFPA02; MPAO1/P1; PA14; Stone 130; DK2; PAK; ATCC 14886; 138244; NCMG1179; RP73; CIG1; MPAO1/P2; ATCC 700888; MSH-10; 2192; ATCC 15692 / PAO1 / 1C / PRS 101 / LM 12228; PA21_ST175; 2_1_26; B136-33; PAO579; E2; 152504; M18; VRFPA01, Pseudomonas sp. P179; ATCC 25324; LESB58; PA7; UCBPP-PA14


Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|Pseudomonas aeruginosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas aeruginosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6I8W: Crystal structure of a membrane phospholipase A from Pseudomonas aeruginosa, a novel bacterial virulence factor
No kinetic





5 substrates (e.g. : 2-Arachidonylglycerol, Lyso-PE(16-0.0-0), Octylglucoside... more)
1 inhbitor:
Undecanoic-acid
Sequence
Graphical view for this peptide sequence: pseae-PA2949
Colored MSA for ABHD6-Lip (raw)
MKRFLLGLVLLLAVAAGVLYFVPATLLASVRTVERGLAGLSEHSVQVDNL
EIAYLEGGSEKNPTLLLIHGFGADKDNWLRFARPLTERYHVVALDLPGFG
DSSKPQQASYDVGTQAERVANFAAAIGVRRLHLAGNSMGGHIAALYAARH
PEQVLSLALIDNAGVMPARKSELFEDLERGENPLVVRQPEDFQKLLDFVF
VQQPPLPAPLKRYLGERAVAASAFNAQIFEQLRQRYIPLEPELPKIEAPT
LLLWGDRDRVLDVSSIEVMRPLLKRPSVVIMENCGHVPMVERPEETAQHY
QAFLDGVRNAQVAGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKRFLLGLVLLLAVAAGVLYFVPATLLASVRTVERGLAGLSEHSVQVDNL
EIAYLEGGSEKNPTLLLIHGFGADKDNWLRFARPLTERYHVVALDLPGFG
DSSKPQQASYDVGTQAERVANFAAAIGVRRLHLAGNSMGGHIAALYAARH
PEQVLSLALIDNAGVMPARKSELFEDLERGENPLVVRQPEDFQKLLDFVF
VQQPPLPAPLKRYLGERAVAASAFNAQIFEQLRQRYIPLEPELPKIEAPT
LLLWGDRDRVLDVSSIEVMRPLLKRPSVVIMENCGHVPMVERPEETAQHY
QAFLDGVRNAQVAGR


References
20 more
    Title: Structural, mechanistic and physiological insights into phospholipase A-mediated membrane phospholipid degradation in Pseudomonas aeruginosa
    Bleffert F, Granzin J, Caliskan M, Schott-Verdugo SN, Siebers M, Thiele B, Rahme LG, Felgner S, Dormann P and Kovacic F <3 more author(s)>
    Ref: Elife, 11:, 2022 : PubMed

            

    Title: Substrate access mechanism in a novel membrane-bound 1 phospholipase A of Pseudomonas aeruginosa concordant with specificity and regioselectivity
    Ahmad S, Strunk CH, Schott-Verdugo SN, Jaeger KE, Kovacic F, Gohlke H
    Ref: Biorxiv, :, 2021 : PubMed

            

    Title: Evidence for a bacterial Lands cycle phospholipase A: Structural and mechanistic insights into membrane phospholipid remodeling
    Bleffert F, Granzin J, Caliskan M, Schott-Verdugo SN, Siebers M, Thiele B, Rahme L, Felgner S, Dormann P and Kovacic F <3 more author(s)>
    Ref: Biorxiv, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer