Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pripa-h3g1q9

Pristionchus pacificus Uncharacterized protein

Relationship
Family|Carb_B_Nematoda
Block| C
Position in NCBI Life Tree|Pristionchus pacificus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Chromadorea: N E > Diplogasterida: N E > Neodiplogasteridae: N E > Pristionchus: N E > Pristionchus pacificus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ABKE02006769
1 UniProt : H3G1Q9
1 UniProt : H3G1Q9
1 Interpro : H3G1Q9
1 Pfam : H3G1Q9
1 PIRSF : H3G1Q9
1 SUPERFAM : H3G1Q9
Sequence
Graphical view for this peptide sequence: pripa-h3g1q9
Colored MSA for Carb_B_Nematoda (raw)
MGGASSYPASRVVDTAYGKVQGRKLVFKGDKCVDAFQGIPFAKPPVGPLR
FKKPEKPDSWDGIRDTTKFGARAIQPPLFFFEKFRKSAPSEDCLYLNVFT
PCWDPPKEGFAVMVYIHGGGFVMGDAETYGDIGMCENLCTRDILVVTIHY
RLAYLGLFTTGDAVCPGNLALWDQTEALKWVQKNIGAFGGNKDNVTVFGQ
SAGGASVDFLHLSPHSTGLFHKGICLAGNTEAPWALASNMVEQCRKKAKL
LGIEENDSSKLIERLREVPADKFGVNMMTQSDKEDFIDLETTPYIDGDFF
PESIDELRKKAASKPLMTGVTAEEGIFFNWSTSSYEISYIAPITEQTDFS
TFLDQLRKKYVDDRNLKDKNNLLRIQAEVHSDYFMNIPTLKWCKKNAENA
QPVYLYLFEHFNVKTLGLGRFVLPILDATHCLELTYLFRKSIFAPFVSTD
SEHAVEDNFSIAFTNFAKFGNPNGGNDFRTDLPAHWKPIDIRNATRNFVF
TADGGHMNENYFGGRPAEVQTMIQLGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGGASSYPASRVVDTAYGKVQGRKLVFKGDKCVDAFQGIPFAKPPVGPLR
FKKPEKPDSWDGIRDTTKFGARAIQPPLFFFEKFRKSAPSEDCLYLNVFT
PCWDPPKEGFAVMVYIHGGGFVMGDAETYGDIGMCENLCTRDILVVTIHY
RLAYLGLFTTGDAVCPGNLALWDQTEALKWVQKNIGAFGGNKDNVTVFGQ
SAGGASVDFLHLSPHSTGLFHKGICLAGNTEAPWALASNMVEQCRKKAKL
LGIEENDSSKLIERLREVPADKFGVNMMTQSDKEDFIDLETTPYIDGDFF
PESIDELRKKAASKPLMTGVTAEEGIFFNWSTSSYEISYIAPITEQTDFS
TFLDQLRKKYVDDRNLKDKNNLLRIQAEVHSDYFMNIPTLKWCKKNAENA
QPVYLYLFEHFNVKTLGLGRFVLPILDATHCLELTYLFRKSIFAPFVSTD
SEHAVEDNFSIAFTNFAKFGNPNGGNDFRTDLPAHWKPIDIRNATRNFVF
TADGGHMNENYFGGRPAEVQTMIQLGR


Reference
    Title: The Pristionchus pacificus genome provides a unique perspective on nematode lifestyle and parasitism
    Dieterich C, Clifton SW, Schuster LN, Chinwalla A, Delehaunty K, Dinkelacker I, Fulton L, Fulton R, Godfrey J and Sommer RJ <7 more author(s)>
    Ref: Nat Genet, 40:1193, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer