Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: portr-a0a1i9kj57

Portunus trituberculatus (Swimming crab) (Neptunus trituberculatus) Carboxylic ester hydrolase

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Portunus trituberculatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Malacostraca: N E > Eumalacostraca: N E > Eucarida: N E > Decapoda: N E > Pleocyemata: N E > Brachyura: N E > Eubrachyura: N E > Heterotremata: N E > Portunoidea: N E > Portunidae: N E > Portunus: N E > Portunus trituberculatus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Methyl-farnesoate
No inhibitor
2 Genbank : KU216467, ALT10384
1 UniProt : A0A1I9KJ57
1 UniProt : A0A1I9KJ57
1 Interpro : A0A1I9KJ57
1 Pfam : A0A1I9KJ57
1 PIRSF : A0A1I9KJ57
1 SUPERFAM : A0A1I9KJ57
Sequence
Graphical view for this peptide sequence: portr-a0a1i9kj57
Colored MSA for Carb_B_Arthropoda (raw)
MKLLTAALVAAAVVEVALCGLQVVTEGGRIQGVGDATINGRTFHAFYSIP
YARPPIGDYRFKDPVKPVTWQRLADATRMPKKCLQVPFVNTILNKHLEPE
EIPGSENCLFLNVFTPVVSSVPEKAKLPVMVWMHGGAFYSGGAEEYLPHA
ILDQDVVLVVVQYRLGVLGFLSTEDSVMPGNLGLKDQTMALEWVQRNIHL
FGGDRKRVTICGESAGGASVHFHMLSPKSRGLFSQVIMQSGTALQSWALN
SRHRQEAETVGRKMGCEDVQNSTALLACLQKVDAKELTASLQDTFQWFLL
PLAFIARVDGDYLPDFPVNLISKKLYNEVDLLAGVTKDEGAMVTRALFVR
EDLVTQLEENFTVIGPLSLSVENEKDSVTLAKTIYDHYMSDINFDDHSSQ
FTQLYSDVSFNLYHDEVTARHAAHFPGRRTFRYEFQHRGEASLSDCYGTE
KGKHWVGHADELFYLFTGGPMFEPFLKEGLTRPDDLHVRDMMLKMWTNFA
TSGNPTPDASLGFTWEPSTADNLHYLAITTSPSMQPDNRKKTRDFFASLP
ISTWRILYADQQQQRQQQQKQQQQTETERVQDEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLLTAALVAAAVVEVALCGLQVVTEGGRIQGVGDATINGRTFHAFYSIP
YARPPIGDYRFKDPVKPVTWQRLADATRMPKKCLQVPFVNTILNKHLEPE
EIPGSENCLFLNVFTPVVSSVPEKAKLPVMVWMHGGAFYSGGAEEYLPHA
ILDQDVVLVVVQYRLGVLGFLSTEDSVMPGNLGLKDQTMALEWVQRNIHL
FGGDRKRVTICGESAGGASVHFHMLSPKSRGLFSQVIMQSGTALQSWALN
SRHRQEAETVGRKMGCEDVQNSTALLACLQKVDAKELTASLQDTFQWFLL
PLAFIARVDGDYLPDFPVNLISKKLYNEVDLLAGVTKDEGAMVTRALFVR
EDLVTQLEENFTVIGPLSLSVENEKDSVTLAKTIYDHYMSDINFDDHSSQ
FTQLYSDVSFNLYHDEVTARHAAHFPGRRTFRYEFQHRGEASLSDCYGTE
KGKHWVGHADELFYLFTGGPMFEPFLKEGLTRPDDLHVRDMMLKMWTNFA
TSGNPTPDASLGFTWEPSTADNLHYLAITTSPSMQPDNRKKTRDFFASLP
ISTWRILYADQQQQRQQQQKQQQQTETERVQDEL


References
    Title: The miRNAs let-7b and miR-141 Coordinately Regulate Vitellogenesis by Modulating Methyl Farnesoate Degradation in the Swimming Crab Portunus trituberculatus
    Yu X, Zhang M, Liu P, Li J, Gao B, Meng X
    Ref: Int J Mol Sci, 25:, 2023 : PubMed

            

    Title: Cloning of two carboxylesterase cDNAs from the swimming crab Portunus trituberculatus: Molecular evidences for their putative roles in methyl farnesotae degradation
    Tao T, Xie X, Liu M, Jiang Q, Zhu D
    Ref: Comparative Biochemistry & Physiology B Biochem Mol Biol, 203:100, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer