Gene_locus Report for: polpa-d3bmm2Polysphondylium pallidum (Cellular slime mold) Putative cholinesterase Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Eukaryota: N E > Amoebozoa: N E > Mycetozoa: N E > Dictyosteliida: N E > Polysphondylium: N E > Polysphondylium pallidum: N E
6_AlphaBeta_hydrolase : polpa-d3bdk1Polysphondylium pallidum (Cellular slime mold) Esterase/lipase/thioesterase domain-containing protein, polpa-d3br91Polysphondylium pallidum (Cellular slime mold) Esterase/lipase/thioesterase domain-containing protein. A85-EsteraseD-FGH : polpa-d3b6x6Polysphondylium pallidum (Cellular slime mold) Esterase. abh_upf0017 : polpa-d3bev2Polysphondylium pallidum (Cellular slime mold) Alpha/beta hydrolase fold-1 domain-containing protein, polpa-d3bev3Polysphondylium pallidum (Cellular slime mold) Alpha/beta hydrolase fold-1 domain-containing protein, polpa-d3bna9Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3btr9Polysphondylium pallidum (Cellular slime mold) Alpha/beta hydrolase fold-1 domain-containing protein. Acidic_Lipase : polpa-d3ayf1Polysphondylium pallidum (Cellular slime mold) Lipase, polpa-d3bfi4Polysphondylium pallidum (Cellular slime mold) Carboxylic ester hydrolase, polpa-d3bh31Polysphondylium pallidum (Cellular slime mold) AB-hydrolase associated lipase region containing protein. BD-FAE : polpa-d3b6z5Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3b706Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3b729Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3b730Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3bjx0Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein. CGI-58_ABHD5_ABHD4 : polpa-d3b7u3Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein. Cholinesterase-like : polpa-d3ayt3Polysphondylium pallidum (Cellular slime mold) Crystal protein, polpa-d3b0x9Polysphondylium pallidum (Cellular slime mold) Carboxylesterase, polpa-d3ban4Polysphondylium pallidum (Cellular slime mold) Neugrin domain-containing protein, polpa-d3bqg0Polysphondylium pallidum (Cellular slime mold) cAMP-regulated D2 protein, polpa-d3brf5Polysphondylium pallidum (Cellular slime mold) Putative cholinesterase, polpa-d3bu30Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein. DLH-S : polpa-d3b1q5Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein. DPP4N_Peptidase_S9 : polpa-d3bma5Polysphondylium pallidum (Cellular slime mold) Dipeptidylpeptidase 8. Duf_900 : polpa-d3bi23Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein. HNLyase_Bact : polpa-d3bcn1Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein. Kynurenine-formamidase : polpa-d3b1n4Polysphondylium pallidum (Cellular slime mold). N-formylkynurenine formamidase. Maspardin-ACP33-SPG21_like : polpa-d3b115Polysphondylium pallidum (Cellular slime mold) Alpha/beta hydrolase fold-1 domain-containing protein. Monoglyceridelipase_lysophospholip : polpa-d3bve2Polysphondylium pallidum (Cellular slime mold) Alpha/beta hydrolase fold protein, polpa-d3bve5Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein. Ndr_family : polpa-d3bff1Polysphondylium pallidum (Cellular slime mold) NDR family protein. PhoPQ_related : polpa-d3awt3Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3bi08.1Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3bi08.2Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3bsh8Polysphondylium pallidum (Cellular slime mold) PhoPQ-activated pathogenicity-related protein. PMH_Peptidase_S9 : polpa-d3bca7Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein. PPase_methylesterase_euk : polpa-d3b0m1Polysphondylium pallidum (Cellular slime mold) Pyruvate kinase. Proline_iminopeptidase : polpa-d3bvi6Polysphondylium pallidum (Cellular slime mold). Proline iminopeptidase. Prolylcarboxypeptidase : polpa-d3avy9Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3awa4Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3b270Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein, polpa-d3beb6Polysphondylium pallidum (Cellular slime mold) Peptidase S28 family protein, polpa-d3bej2Polysphondylium pallidum (Cellular slime mold) Putative serine protease, polpa-d3bnb4Polysphondylium pallidum (Cellular slime mold) Peptidase S28 family protein, polpa-d3bp50Polysphondylium pallidum (Cellular slime mold) Putative uncharacterized protein. S9N_PREPL_Peptidase_S9 : polpa-d3bsr4Polysphondylium pallidum (Cellular slime mold) Oligopeptidase B
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: polpa-d3bmm2 Colored MSA for Cholinesterase-like (raw)
MNNSICLLQYTNAFDFMSVSDLDDTVQAQTTGGLIQGLRYDDYAVFYGIP
FAAPPVGPARWQPPTDPESWQPKVLDARYPQFGCPQNCELPPGTCPTNTS
ENCLYLNVFVPISALPLGPNDATRPVMAFLPGGRFEQGAAATVLYNARTM
VNSSDAIVVTINYRLGVLGFLITDEFSGNYGFLDQRQALMWIQNNIAYFG
GDRTRVTLCGQSAGATSIAAHITSPLSFGLFHQAISESNPYLLDLKTREI
ETKNSMNFAKAVGCPTADASCLYQLTPEEIIQGQIKAQNEIDILIPLALF
LPWTPTVDGTEIFDQPINLIKQGKFYEIPMIVGTCMEEALLFIYQAANKS
ISKFEYEIGMDGLFLNLDDAKQVIAQYPPISGDNRPVLSVIGTDYIFVCP
NRNMTRYLSRSETIYTYQFQHVLSFDAWGPLYPNCVGHVCHGSELPFVFN
SASLGGYTFTPDEQTLAYAMNNYWMNFVVNGNPNIGLPVPTQWPTFNETG
DQTLIFQAPTPYVESGLLSQKCDFWDSMGYDNPVR
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MNNSICLLQYTNAFDFMSVSDLDDTVQAQTTGGLIQGLRYDDYAVFYGIP FAAPPVGPARWQPPTDPESWQPKVLDARYPQFGCPQNCELPPGTCPTNTS ENCLYLNVFVPISALPLGPNDATRPVMAFLPGGRFEQGAAATVLYNARTM VNSSDAIVVTINYRLGVLGFLITDEFSGNYGFLDQRQALMWIQNNIAYFG GDRTRVTLCGQSAGATSIAAHITSPLSFGLFHQAISESNPYLLDLKTREI ETKNSMNFAKAVGCPTADASCLYQLTPEEIIQGQIKAQNEIDILIPLALF LPWTPTVDGTEIFDQPINLIKQGKFYEIPMIVGTCMEEALLFIYQAANKS ISKFEYEIGMDGLFLNLDDAKQVIAQYPPISGDNRPVLSVIGTDYIFVCP NRNMTRYLSRSETIYTYQFQHVLSFDAWGPLYPNCVGHVCHGSELPFVFN SASLGGYTFTPDEQTLAYAMNNYWMNFVVNGNPNIGLPVPTQWPTFNETG DQTLIFQAPTPYVESGLLSQKCDFWDSMGYDNPVR
|
|
|