Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pholu-lxd2

Photorhabdus luminescens (Xenorhabdus luminescens), Photorhabdus asymbiotica, thioesterase (c14acp-te)

Comment
Other strains: Photorhabdus luminescens (Xenorhabdus luminescens) Photorhabdus asymbiotica subsp. asymbiotica (strain ATCC 43949 3105-77) (Xenorhabdus luminescens (strain 2))


Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Photorhabdus luminescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Morganellaceae: N E > Photorhabdus: N E > Photorhabdus luminescens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : M90092, M62917, FM162591
2 UniProt : P23148, C7BN06
2 UniProt : P23148, C7BN06
2 Interpro : P23148, C7BN06
2 Pfam : P23148, C7BN06
2 PIRSF : P23148, C7BN06
2 SUPERFAM : P23148, C7BN06
Sequence
Graphical view for this peptide sequence: pholu-lxd2
Colored MSA for Thioesterase_acyl-transferase (raw)
MENKSRYKTIDHVICVEENRKIHVWETLPKENSPKRKNTLIIASGFARRM
DHFAGLAEYLSQNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVD
WLNTRKINNLGMLASSLSARIAYASLSEINVSFLITAVGVVNLRYTLERA
LGFDYLSLPIDELPDNLDFEGHKLGAEVFARDCFDSGWEDLTSTINSMMH
LDIPFIAFTANNDDWVKQDEVITLLSSIRSHQCKIYSLLGSSHDLGENLV
VLRNFYQSVTKAAIAMDNGCLDIDVDIIEPSFEHLTIAAVNERRMKIEIE
NQVISLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MENKSRYKTIDHVICVEENRKIHVWETLPKENSPKRKNTLIIASGFARRM
DHFAGLAEYLSQNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVD
WLNTRKINNLGMLASSLSARIAYASLSEINVSFLITAVGVVNLRYTLERA
LGFDYLSLPIDELPDNLDFEGHKLGAEVFARDCFDSGWEDLTSTINSMMH
LDIPFIAFTANNDDWVKQDEVITLLSSIRSHQCKIYSLLGSSHDLGENLV
VLRNFYQSVTKAAIAMDNGCLDIDVDIIEPSFEHLTIAAVNERRMKIEIE
NQVISLS


References
    Title: Comparative genomics of the emerging human pathogen Photorhabdus asymbiotica with the insect pathogen Photorhabdus luminescens
    Wilkinson P, Waterfield NR, Crossman L, Corton C, Sanchez-Contreras M, Vlisidou I, Barron A, Bignell A, Clark L and ffrench-Constant RH <10 more author(s)>
    Ref: BMC Genomics, 10:302, 2009 : PubMed

            

    Title: Multiple repetitive elements and organization of the lux operons of luminescent terrestrial bacteria
    Meighen EA, Szittner RB
    Ref: Journal of Bacteriology, 174:5371, 1992 : PubMed

            

    Title: Cloning and nucleotide sequences of lux genes and characterization of luciferase of Xenorhabdus luminescens from a human wound
    Xi L, Cho KW, Tu SC
    Ref: Journal of Bacteriology, 173:1399, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer