Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pholu-lxd1

Photorhabdus luminescens (Xenorhabdus luminescens) thioesterase

Comment
Warning: the serine 77 in GXSXG motif is not the active site serine 114 as determined by X ray structure AASLS in Vibrio harveyi see Lawson_1994_Biochemistry_33_9382


Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Photorhabdus luminescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Morganellaceae: N E > Photorhabdus: N E > Photorhabdus luminescens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: X53783, M57416, M90093
1 UniProt : P19197
1 UniProt : P19197
1 Interpro : P19197
1 Pfam : P19197
1 PIRSF : P19197
1 SUPERFAM : P19197
Sequence
Graphical view for this peptide sequence: pholu-lxd1
Colored MSA for Thioesterase_acyl-transferase (raw)
MENESKYKTIDHVICVEGNKKIHVWETLPEENSPKRKNAIIIASGFARRM
DHFAGLAEYLSRNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVD
WLTTRKINNFGMLASSLSARIAYASLSEINASFLITAVGFVNLRYSLERA
LGFDYLSLPINELPNNLDFEGHKLGAEVFARDCLDFGWEDLASTINNMMY
LDIPFIAFTANNDNWVKQDEVITLLSNIRSNRCKIYSLLGSSHDLSENLV
VLRNFYQSVTKAAIAMDNDHLDIDVDITEPSFEHLTIATVNERRMRIEIE
NQAISLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MENESKYKTIDHVICVEGNKKIHVWETLPEENSPKRKNAIIIASGFARRM
DHFAGLAEYLSRNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVD
WLTTRKINNFGMLASSLSARIAYASLSEINASFLITAVGFVNLRYSLERA
LGFDYLSLPINELPNNLDFEGHKLGAEVFARDCLDFGWEDLASTINNMMY
LDIPFIAFTANNDNWVKQDEVITLLSNIRSNRCKIYSLLGSSHDLSENLV
VLRNFYQSVTKAAIAMDNDHLDIDVDITEPSFEHLTIATVNERRMRIEIE
NQAISLS


References
3 more
    Title: Multiple repetitive elements and organization of the lux operons of luminescent terrestrial bacteria
    Meighen EA, Szittner RB
    Ref: Journal of Bacteriology, 174:5371, 1992 : PubMed

            

    Title: The nucleotide sequence of the luxD gene of Xenorhabdus luminescens Hm
    Cochrum L, Hruska KS, Rucker EB, Johnston TC
    Ref: Nucleic Acids Research, 18:5570, 1990 : PubMed

            

    Title: Nucleotide sequence, expression, and properties of luciferase coded by lux genes from a terrestrial bacterium
    Szittner R, Meighen E
    Ref: Journal of Biological Chemistry, 265:16581, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer