Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pholu-LUXD2

Photorhabdus luminescens (Xenorhabdus luminescens) and (subsp. laumondii) acyl transferase

Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Photorhabdus luminescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Morganellaceae: N E > Photorhabdus: N E > Photorhabdus luminescens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF403784, BX571866
2 UniProt : Q93CP5, Q7N576
2 UniProt : Q93CP5, Q7N576
2 Interpro : Q93CP5, Q7N576
2 Pfam : Q93CP5, Q7N576
2 PIRSF : Q93CP5, Q7N576
2 SUPERFAM : Q93CP5, Q7N576
Sequence
Graphical view for this peptide sequence: pholu-LUXD2
Colored MSA for Thioesterase_acyl-transferase (raw)
MENKSKYKTIDHVLCVEGNKKIHVWETLPEETSPKRKNPIIIASGFARRM
DHFAGLAEYLSRNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVD
WLNTRKINNRGILASSLSARIVYASLSEINVSFLITAVGVVNLRYTLERA
LGFDYLSLPINELPNNLDFEGHKLGAEVFARDCLDFGWEDLTSTINSMMY
LDIPFIAFTANNDNWVKQDEVITLLSNIRSNRCKIHSLLGSSHDLCVFLV
VLRNFYQSVTKAAIAMDNDRLDIDVDIIEPSFEHLTIATVNERRMKIEIE
NQAISLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MENKSKYKTIDHVLCVEGNKKIHVWETLPEETSPKRKNPIIIASGFARRM
DHFAGLAEYLSRNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVD
WLNTRKINNRGILASSLSARIVYASLSEINVSFLITAVGVVNLRYTLERA
LGFDYLSLPINELPNNLDFEGHKLGAEVFARDCLDFGWEDLTSTINSMMY
LDIPFIAFTANNDNWVKQDEVITLLSNIRSNRCKIHSLLGSSHDLCVFLV
VLRNFYQSVTKAAIAMDNDRLDIDVDIIEPSFEHLTIATVNERRMKIEIE
NQAISLS


Reference
    Title: The genome sequence of the entomopathogenic bacterium Photorhabdus luminescens
    Duchaud E, Rusniok C, Frangeul L, Buchrieser C, Givaudan A, Taourit S, Bocs S, Boursaux-Eude C, Chandler M and Kunst F <16 more author(s)>
    Ref: Nat Biotechnol, 21:1307, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer