Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phole-lxd2

Photobacterium leiognathi Photobacterium mondopomensis thioesterase (c14acp-te)

Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Photobacterium leiognathi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Photobacterium: N E > Photobacterium leiognathi: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: X65612, EU122285, DQ988877
3 UniProt : Q06878, B2XS03, Q6VFN2
3 UniProt : Q06878, B2XS03, Q6VFN2
3 Interpro : Q06878, B2XS03, Q6VFN2
3 Pfam : Q06878, B2XS03, Q6VFN2
3 PIRSF : Q06878, B2XS03, Q6VFN2
3 SUPERFAM : Q06878, B2XS03, Q6VFN2
Sequence
Graphical view for this peptide sequence: phole-lxd2
Colored MSA for Thioesterase_acyl-transferase (raw)
MKNTQTSAPIDHMISLGDNRHIRVWETLPKNQEIKRNNTIVIAAGFARRM
DHFAGLAEYLANNGFHVIRYDSLNHVGLSSGEINQFSMSVGKHSLLTVIE
WLKGRGIDQIGLIASSLSARIAYDVAAEINLSFLITAVGVVNLRSTLEKA
LKYDYLQMEINDIPEDLDFEGYNLGSKVFVTDCFDNNWDSLDSTINKTKD
LDIPFIAFISNGDDWVCQQEVKKLVGNMNSDKTKIYSLIGSSHDLGENLI
VLRNFYQSVTRAAIRVDSEVIDLVDDISEPNFEDLTIITVNERRLKNKIA
KRNVR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKNTQTSAPIDHMISLGDNRHIRVWETLPKNQEIKRNNTIVIAAGFARRM
DHFAGLAEYLANNGFHVIRYDSLNHVGLSSGEINQFSMSVGKHSLLTVIE
WLKGRGIDQIGLIASSLSARIAYDVAAEINLSFLITAVGVVNLRSTLEKA
LKYDYLQMEINDIPEDLDFEGYNLGSKVFVTDCFDNNWDSLDSTINKTKD
LDIPFIAFISNGDDWVCQQEVKKLVGNMNSDKTKIYSLIGSSHDLGENLI
VLRNFYQSVTRAAIRVDSEVIDLVDDISEPNFEDLTIITVNERRLKNKIA
KRNVR


References
2 more
    Title: Phylogenetic analysis of the incidence of lux gene horizontal transfer in Vibrionaceae
    Urbanczyk H, Ast JC, Kaeding AJ, Oliver JD, Dunlap PV
    Ref: Journal of Bacteriology, 190:3494, 2008 : PubMed

            

    Title: Phylogenetic analysis of the lux operon distinguishes two evolutionarily distinct clades of Photobacterium leiognathi
    Ast JC, Dunlap PV
    Ref: Arch Microbiol, 181:352, 2004 : PubMed

            

    Title: Sequence of the luxD gene encoding acyltransferase of the lux operon from Photobacterium leiognathi
    Chao YF, Weng SF, Lin JW
    Ref: Gene, 126:155, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer