Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phole-lxd1

Photobacterium leiognathi subsp. leiognathi Photobacterium mondopomensis Photobacterium damselae thioesterase (c14acp-te)

Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Photobacterium leiognathi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Photobacterium: N E > Photobacterium leiognathi: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 8 more: M63594, X08036, EF536332
>3 UniProt links 3 more: P21309, A7KQK6, A7KQL9
>3 UniProt links 3 more: P21309, A7KQK6, A7KQL9
>3 Interpro links 3 more: P21309, A7KQK6, A7KQL9
>3 Pfam links 3 more: P21309, A7KQK6, A7KQL9
>3 PIRSF links 3 more: P21309, A7KQK6, A7KQL9
>3 SUPERFAM links 3 more: P21309, A7KQK6, A7KQL9
Sequence
Graphical view for this peptide sequence: phole-lxd1
Colored MSA for Thioesterase_acyl-transferase (raw)
MENTQHSLPIDHVIDIGDNRYIRVWETKPKNKETKRNNTIVIASGFARRM
DHFAGLAEYLANNGFRVIRYDSLNHVGLSSGEIKQFSMSVGKHSLLTVID
WLKERNINNIGLIASSLSARIAYEVAAEIDLSFLITAVGVVNLRSTLEKA
LKYDYLQMEVNTIPEDLIFEGHNLGSKVFVTDCFENNWDSLDSTINKICE
LDIPFIAFTSDGDDWVCQHEVKHLVSNVKSDKKKIYSLVGSSHDLGENLV
VLRNFYQSMTKAAVSLDRQLVELVDEIIEPNFEDLTVITVNERRLKNKIE
NEIINRLADRVLASV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MENTQHSLPIDHVIDIGDNRYIRVWETKPKNKETKRNNTIVIASGFARRM
DHFAGLAEYLANNGFRVIRYDSLNHVGLSSGEIKQFSMSVGKHSLLTVID
WLKERNINNIGLIASSLSARIAYEVAAEIDLSFLITAVGVVNLRSTLEKA
LKYDYLQMEVNTIPEDLIFEGHNLGSKVFVTDCFENNWDSLDSTINKICE
LDIPFIAFTSDGDDWVCQHEVKHLVSNVKSDKKKIYSLVGSSHDLGENLV
VLRNFYQSMTKAAVSLDRQLVELVDEIIEPNFEDLTVITVNERRLKNKIE
NEIINRLADRVLASV


References
3 more
    Title: Natural merodiploidy of the lux-rib operon of Photobacterium leiognathi from coastal waters of Honshu, Japan
    Ast JC, Urbanczyk H, Dunlap PV
    Ref: Journal of Bacteriology, 189:6148, 2007 : PubMed

            

    Title: The lux genes of the luminous bacterial symbiont, Photobacterium leiognathi, of the ponyfish. Nucleotide sequence, difference in gene organization, and high expression in mutant Escherichia coli
    Lee CY, Szittner RB, Meighen EA
    Ref: European Journal of Biochemistry, 201:161, 1991 : PubMed

            

    Title: Isolation of bioluminescent functions from Photobacterium leiognathi: analysis of luxA, luxB, luxG and neighboring genes
    Illarionov BA, Blinov VM, Donchenko AP, Protopopova MV, Karginov VA, Mertvetsov NP, Gitelson JI
    Ref: Gene, 86:89, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer