Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: penva-a0a3r7m6s0

Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei) juvenile hormone epoxide hydrolase 1-like

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Penaeus vannamei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Malacostraca: N E > Eumalacostraca: N E > Eucarida: N E > Decapoda: N E > Dendrobranchiata: N E > Penaeoidea: N E > Penaeidae: N E > Litopenaeus: N E > Penaeus vannamei: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : XP_027223682
1 UniProt : A0A3R7M6S0
1 UniProt : A0A3R7M6S0
1 Interpro : A0A3R7M6S0
1 Pfam : A0A3R7M6S0
1 PIRSF : A0A3R7M6S0
1 SUPERFAM : A0A3R7M6S0
Sequence
Graphical view for this peptide sequence: penva-a0a3r7m6s0
Colored MSA for Epoxide_hydrolase (raw)
MPLRLMSWMKLFSAAIVIAALLYKIREKSMAESPMPELDPDPWWGPGERE
KGDDSVRNFKIAISNQDLDDLKARLSLPLRLTPPLENANFTYGMNQNTLK
EIVQHWRLKYDWRKREALLNYYPHFMTKIEGLDIHFMRGSAQTKGAKNIK
VLPLLLIHGWPGTFVEFYDIMPLLTTPQEDSNVVFEVICPSIPGYGFSQG
SAKQGLSHLETAQIFLKLMKRLGYDQFYLQGGDWGSIIATSMATMYPENI
LGIHLNMFVANSLGPNLKLILGAILPAGIVVSHEDQEKLYPLTEKFGMFA
RETGYLHIQATKPDTIGAALNQSPVSLAAYIMEKFSSWTHRDNYKEVNGG
LLHKHFPIDIDKILDNICIYWFTGSITTSVRYYAENFSPKAVANNLDSIP
CRVPSAMSAFPHDLLNQPKNFIAHKFYDIVSYSDQLVGGHFAAMERPKLL
ARDFHQFVNTVETREN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLRLMSWMKLFSAAIVIAALLYKIREKSMAESPMPELDPDPWWGPGERE
KGDDSVRNFKIAISNQDLDDLKARLSLPLRLTPPLENANFTYGMNQNTLK
EIVQHWRLKYDWRKREALLNYYPHFMTKIEGLDIHFMRGSAQTKGAKNIK
VLPLLLIHGWPGTFVEFYDIMPLLTTPQEDSNVVFEVICPSIPGYGFSQG
SAKQGLSHLETAQIFLKLMKRLGYDQFYLQGGDWGSIIATSMATMYPENI
LGIHLNMFVANSLGPNLKLILGAILPAGIVVSHEDQEKLYPLTEKFGMFA
RETGYLHIQATKPDTIGAALNQSPVSLAAYIMEKFSSWTHRDNYKEVNGG
LLHKHFPIDIDKILDNICIYWFTGSITTSVRYYAENFSPKAVANNLDSIP
CRVPSAMSAFPHDLLNQPKNFIAHKFYDIVSYSDQLVGGHFAAMERPKLL
ARDFHQFVNTVETREN


Reference
    Title: The juvenile hormone epoxide hydrolase homolog in Penaeus vannamei plays immune-related functions
    Liu Z, Huang Z, Zheng X, Zheng Z, Yao D, Zhang Y, Aweya JJ
    Ref: Dev Comp Immunol, 132:104410, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer