Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: penva-LvFSH

Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei) LvFSH. FSH1 domain-containing protein

Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Penaeus vannamei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Malacostraca: N E > Eumalacostraca: N E > Eucarida: N E > Decapoda: N E > Dendrobranchiata: N E > Penaeoidea: N E > Penaeidae: N E > Litopenaeus: N E > Penaeus vannamei: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : XP_027218885
1 UniProt : A0A3R7MXL5
1 UniProt : A0A3R7MXL5
1 Interpro : A0A3R7MXL5
1 Pfam : A0A3R7MXL5
1 PIRSF : A0A3R7MXL5
1 SUPERFAM : A0A3R7MXL5
Sequence
Graphical view for this peptide sequence: penva-LvFSH
Colored MSA for FSH1 (raw)
MTEKSTKRPLRILCLHGYRQNGSTFREKTGAFRKLLKKQVEFEFMTSPLE
VPPLESADDKDGGSGWWFSRPDDYFRAQDESDCVKGFEESLGAVETAFKE
KGPFDGILGFSQGGAMLGLICGLQQQGKLSYSFKFAIFVSAFKSRSLPHQ
HLYAEKITLPTLHVFGETDQVIEKPMSEEHLQYFHDPEILMHPGGHFIPA
AGAQKAVYVKFIEKMRELCG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTEKSTKRPLRILCLHGYRQNGSTFREKTGAFRKLLKKQVEFEFMTSPLE
VPPLESADDKDGGSGWWFSRPDDYFRAQDESDCVKGFEESLGAVETAFKE
KGPFDGILGFSQGGAMLGLICGLQQQGKLSYSFKFAIFVSAFKSRSLPHQ
HLYAEKITLPTLHVFGETDQVIEKPMSEEHLQYFHDPEILMHPGGHFIPA
AGAQKAVYVKFIEKMRELCG


Reference
    Title: Biochemical Characterization of a Novel alpha/beta-Hydrolase/FSH from the White Shrimp Litopenaeus vannamei
    Garcia-Orozco KD, Cinco-Moroyoqui F, Angulo-Sanchez LT, Marquez-Rios E, Burgos-Hernandez A, Cardenas-Lopez JL, Gomez-Aguilar C, Corona-Martinez DO, Saab-Rincon G, Sotelo-Mundo RR
    Ref: Biomolecules, 9:, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer