Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pedhc-e0vcd0

Pediculus humanus corporis (Body louse) Neurotactin, putative

Relationship
Family|Neurotactin
Block| C
Position in NCBI Life Tree|Pediculus humanus corporis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Psocodea: N E > Phthiraptera: N E > Anoplura: N E > Pediculidae: N E > Pediculus: N E > Pediculus humanus: N E > Pediculus humanus corporis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DS235053
1 UniProt : E0VCD0
1 UniProt : E0VCD0
1 Interpro : E0VCD0
1 Pfam : E0VCD0
1 PIRSF : E0VCD0
1 SUPERFAM : E0VCD0
Sequence
Graphical view for this peptide sequence: pedhc-e0vcd0
Colored MSA for Neurotactin (raw)
MERQDEIEQIRNDVEIIKTGEVEKMKKQLEASQKELGSSVRVPIGGIKIP
GFLRSRKTKETDENSTEPDIEPPFVAQNVRKEDDKEPETQRQLIAKRFRK
IITRMPLTKSGEGGGGGDDDDDNIENRDDAKDEKNLNTKKQKSFFNSIRI
PLISDRPKKLNREFKNECSDIYLMFKKPLFMCLHLFCTYEAPNVGKTTKD
MEMGTAGLASMETLEDSKESNGLVEDGMETVKLDVDDSKDVESQELASKR
KQGVFGTWSVRDWRNWPEKMRRLTKHEKAIIAAIILFLILLILIIILLAG
SKQATSPPIKDGRYIVTSSSCGPIEGIFDEGIFKFHGIPYAVPPLGSKRW
KYAEPLDQIDKCWNGTLKAYNRTSTCWQIYMEPNRKWRIDGAENCLTLDI
QTPFVRYDTPVPVIVLIDSGTLVGGSPGILKPTAKIIRSKEVVFVRPNFR
LGIFGFLAADVLSKSTYPPVSGNYGLSDIITALKWIKTNIVHFGGDPNMI
TVLGHRAGATLTTALVSSHAAKNLFNRAWASSGSVIFPDKVLQLSEQANQ
RYIDRICAQKPDKLYCLKSYDAEELVEELEDSWRPTISDLPANYEANTTK
HEWLVLDGNILKEGLWHDNSQQHTTLVLGTTAHSEASPQLWEKLQKIPGP
KEEAIIEHVKGSYIGTMGLTNEALKLYNNSWEDLTAMISDIRTICPTLNF
VRSQGAQQNVSFYVAKLERNHTDFGQIADIGVDMSSILGTYEPRTTAQRN
FVSTIQDLFYNYVNHGEWTVKNREGVLIIGEKGEWFDDYPNCNFWISKNF
VPKFARRD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERQDEIEQIRNDVEIIKTGEVEKMKKQLEASQKELGSSVRVPIGGIKIP
GFLRSRKTKETDENSTEPDIEPPFVAQNVRKEDDKEPETQRQLIAKRFRK
IITRMPLTKSGEGGGGGDDDDDNIENRDDAKDEKNLNTKKQKSFFNSIRI
PLISDRPKKLNREFKNECSDIYLMFKKPLFMCLHLFCTYEAPNVGKTTKD
MEMGTAGLASMETLEDSKESNGLVEDGMETVKLDVDDSKDVESQELASKR
KQGVFGTWSVRDWRNWPEKMRRLTKHEKAIIAAIILFLILLILIIILLAG
SKQATSPPIKDGRYIVTSSSCGPIEGIFDEGIFKFHGIPYAVPPLGSKRW
KYAEPLDQIDKCWNGTLKAYNRTSTCWQIYMEPNRKWRIDGAENCLTLDI
QTPFVRYDTPVPVIVLIDSGTLVGGSPGILKPTAKIIRSKEVVFVRPNFR
LGIFGFLAADVLSKSTYPPVSGNYGLSDIITALKWIKTNIVHFGGDPNMI
TVLGHRAGATLTTALVSSHAAKNLFNRAWASSGSVIFPDKVLQLSEQANQ
RYIDRICAQKPDKLYCLKSYDAEELVEELEDSWRPTISDLPANYEANTTK
HEWLVLDGNILKEGLWHDNSQQHTTLVLGTTAHSEASPQLWEKLQKIPGP
KEEAIIEHVKGSYIGTMGLTNEALKLYNNSWEDLTAMISDIRTICPTLNF
VRSQGAQQNVSFYVAKLERNHTDFGQIADIGVDMSSILGTYEPRTTAQRN
FVSTIQDLFYNYVNHGEWTVKNREGVLIIGEKGEWFDDYPNCNFWISKNF
VPKFARRD


Reference
    Title: Genome sequences of the human body louse and its primary endosymbiont provide insights into the permanent parasitic lifestyle
    Kirkness EF, Haas BJ, Sun W, Braig HR, Perotti MA, Clark JM, Lee SH, Robertson HM, Kennedy RC and Pittendrigh BR <61 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 107:12168, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer