Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: parte-a0e8v9

Paramecium tetraurelia Chromosome undetermined scaffold_83, whole genome shotgun sequence

Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Paramecium tetraurelia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Ciliophora: N E > Intramacronucleata: N E > Oligohymenophorea: N E > Peniculida: N E > Parameciidae: N E > Paramecium: N E > Paramecium tetraurelia: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CT868664
1 UniProt : A0E8V9
1 UniProt : A0E8V9
1 Interpro : A0E8V9
1 Pfam : A0E8V9
1 PIRSF : A0E8V9
1 SUPERFAM : A0E8V9
Sequence
Graphical view for this peptide sequence: parte-a0e8v9
Colored MSA for Acidic_Lipase (raw)
MNFQIIQTITFYFFIWVLKPIANVGLSLTYYSAYIAIYLTDYVLSLFVRE
CESRNPTIFHNLRKVLNKLKPYSGVYTQATDIILAQGYNFESHKVITEDG
YILTMWRIYKDGTHPHPHPIILQHGLLDSSWSWFINNDKKLTLPYILAEQ
GYDVWLANNRGNKYSIGHTKFQSVNYNQQYWDCSFDDLAKYDFKAIVLYV
KNITQRAKVIYLGHSQGTTQAFAYLSNNIEFQNHLKCFIGLGPAMFISNL
RSTFLQWAIKLYIFEIIYYLGIPYFFVFDDGFNIKIGALCYMIPLIFRNF
FFEITNQLCGFPQKNKIDLTRFGNMVAHEPGGCATKNIVQWMQFFRSKQL
QYFDYGATQNQALYGQRDPPPYPVDNLKNFTIPKYFYLGTKDVITDTDDL
GKMLNKLDQTHMKVEFIDDYAHLDYVWAVDAHVKLYPSILRNIKENQN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNFQIIQTITFYFFIWVLKPIANVGLSLTYYSAYIAIYLTDYVLSLFVRE
CESRNPTIFHNLRKVLNKLKPYSGVYTQATDIILAQGYNFESHKVITEDG
YILTMWRIYKDGTHPHPHPIILQHGLLDSSWSWFINNDKKLTLPYILAEQ
GYDVWLANNRGNKYSIGHTKFQSVNYNQQYWDCSFDDLAKYDFKAIVLYV
KNITQRAKVIYLGHSQGTTQAFAYLSNNIEFQNHLKCFIGLGPAMFISNL
RSTFLQWAIKLYIFEIIYYLGIPYFFVFDDGFNIKIGALCYMIPLIFRNF
FFEITNQLCGFPQKNKIDLTRFGNMVAHEPGGCATKNIVQWMQFFRSKQL
QYFDYGATQNQALYGQRDPPPYPVDNLKNFTIPKYFYLGTKDVITDTDDL
GKMLNKLDQTHMKVEFIDDYAHLDYVWAVDAHVKLYPSILRNIKENQN


Reference
    Title: Global trends of whole-genome duplications revealed by the ciliate Paramecium tetraurelia
    Aury JM, Jaillon O, Duret L, Noel B, Jubin C, Porcel BM, Segurens B, Daubin V, Anthouard V and Wincker P <33 more author(s)>
    Ref: Nature, 444:171, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer