Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: olean-r4yv64

Oleispira antarctica RB-8. Uncharacterized protein

Relationship
Family|abh_upf00227
Block| X
Position in NCBI Life Tree|Oleispira antarctica RB-8
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Oceanospirillaceae: N E > Oleispira: N E > Oleispira antarctica: N E > Oleispira antarctica RB-8: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FO203512
1 UniProt : R4YV64
1 UniProt : R4YV64
1 Interpro : R4YV64
1 Pfam : R4YV64
1 PIRSF : R4YV64
1 SUPERFAM : R4YV64
Sequence
Graphical view for this peptide sequence: olean-r4yv64
Colored MSA for abh_upf00227 (raw)
MILPSNIACVYLHGFLSSPKSKKAQELIQFFADHQIQNQLCVPTLSFEPA
VAIQQAQEAIHTLQQQDGIDQVFVMGSSLGGFYATYLAQQENIKAVLINP
AVRPYDLFDKYLGPNEHFYDGKTYLLETKHIEQLQAIDVEELTRPNDQLL
LLQTGDETLDYRWATKKYIDCPSWIEPGGNHSYEGFMGKLASIFYFVQR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MILPSNIACVYLHGFLSSPKSKKAQELIQFFADHQIQNQLCVPTLSFEPA
VAIQQAQEAIHTLQQQDGIDQVFVMGSSLGGFYATYLAQQENIKAVLINP
AVRPYDLFDKYLGPNEHFYDGKTYLLETKHIEQLQAIDVEELTRPNDQLL
LLQTGDETLDYRWATKKYIDCPSWIEPGGNHSYEGFMGKLASIFYFVQR


Reference
    Title: Genome sequence and functional genomic analysis of the oil-degrading bacterium Oleispira antarctica
    Kube M, Chernikova TN, Al-Ramahi Y, Beloqui A, Lopez-Cortez N, Guazzaroni ME, Heipieper HJ, Klages S, Kotsyurbenko OR and Golyshin PN <26 more author(s)>
    Ref: Nat Commun, 4:2156, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer