Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nitgg-k0im51

Nitrososphaera gargensis (strain Ga9.2). Putative alpha/beta hydrolase fold protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Nitrososphaera gargensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Thaumarchaeota: N E > Nitrososphaeria: N E > Nitrososphaerales: N E > Nitrososphaeraceae: N E > Nitrososphaera: N E > Candidatus Nitrososphaera gargensis: N E


Molecular evidence
Database
No mutation
1 structure:
5A62: Hydrolytic potential of the ammonia-oxidizing Thaumarchaeon Nitrososphaera gargenis - crystal structure and activity profiles of carboxylesterases linked to their metabolic function
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002408
1 UniProt : K0IM51
1 Structure : 5A62
1 UniProt : K0IM51
1 Interpro : K0IM51
1 Pfam : K0IM51
1 PIRSF : K0IM51
1 SUPERFAM : K0IM51
Sequence
Graphical view for this peptide sequence: nitgg-k0im51
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPFLSSPSNSVSTYYEDHGDARSYPLVLIHPIGGNILIWDYEIQLLLKSG
FRVIAYELRGHHRTNMGKTGAYTMQDLIDDLRRLLEHLNIGKCTIIGHSI
GGIISSMYAAQHPGKVDAIIMINGSPKKFQEKDLEKHFRTREVAITQGMK
ALAEHKLVSLDEARDLFADKRHADFFREVFTKTSVEGFVAATVALYTIPG
NVVQGLRASGCKVFAIVGSDDDVFMRLIKETKEEIPEMELRVLQGSDHWV
VIEKPKEMYDILMGFLAIVTKDVKPVG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPFLSSPSNSVSTYYEDHGDARSYPLVLIHPIGGNILIWDYEIQLLLKSG
FRVIAYELRGHHRTNMGKTGAYTMQDLIDDLRRLLEHLNIGKCTIIGHSI
GGIISSMYAAQHPGKVDAIIMINGSPKKFQEKDLEKHFRTREVAITQGMK
ALAEHKLVSLDEARDLFADKRHADFFREVFTKTSVEGFVAATVALYTIPG
NVVQGLRASGCKVFAIVGSDDDVFMRLIKETKEEIPEMELRVLQGSDHWV
VIEKPKEMYDILMGFLAIVTKDVKPVG


References
    Title: Cloning, expression, purification and preliminary X-ray analysis of EstN2, a novel archaeal alpha/beta-hydrolase from Candidatus Nitrososphaera gargensis
    Kaljunen H, Chow J, Streit WR, Mueller-Dieckmann J
    Ref: Acta Crystallographica F Struct Biol Commun, 70:1394, 2014 : PubMed

            

    Title: The genome of the ammonia-oxidizing Candidatus Nitrososphaera gargensis: insights into metabolic versatility and environmental adaptations
    Spang A, Poehlein A, Offre P, Zumbragel S, Haider S, Rychlik N, Nowka B, Schmeisser C, Lebedeva EV and Wagner M <10 more author(s)>
    Ref: Environ Microbiol, 14:3122, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer