Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nillu-ACHE2

Nilaparvata lugens (Brown planthopper) ace gene for acetylcholinesterase precursor

Comment
B6VQ29 is the sequence of the resistant strain mutation G185S (or G185R?). Q5W1L0 from the suceptible strain


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Nilaparvata lugens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Auchenorrhyncha: N E > Fulgoromorpha: N E > Fulgoroidea: N E > Delphacidae: N E > Delphacinae: N E > Nilaparvata: N E > Nilaparvata lugens: N E


Molecular evidence
Database
1 mutation: nillu-ACHE2
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AJ852420, FM866396, JN688930
3 UniProt : Q5W1L0, B6VQ29, H9N1D1
1 Ncbi-nid : 54792409
1 Ncbi-pid : 54792410
3 UniProt : Q5W1L0, B6VQ29, H9N1D1
3 Interpro : Q5W1L0, B6VQ29, H9N1D1
3 Pfam : Q5W1L0, B6VQ29, H9N1D1
3 PIRSF : Q5W1L0, B6VQ29, H9N1D1
3 SUPERFAM : Q5W1L0, B6VQ29, H9N1D1
Sequence
Graphical view for this peptide sequence: nillu-ACHE2
Colored MSA for ACHE (raw)
MTSKMDTKQASTEPWKTAVLGAMFTMMVLSGKIEGRSFSQERQHEEMKES
SGHMHHSDPLIVETHSGHVRGISKTVLGREVHVFTGIPFAKPPIGPLRFR
KPVPVDPWHGVLDATALPNSCYQERYEYFPGFEGEEMWNPNTNLSEDCLY
LNIWVPHRLRIRHRANSEENKPRAKVPVLIWIYGGGYMSGTATLDVYDAD
MVAATSDVIVASMQYRVGAFGFLYLAQDLPRGSEEAPGNMGLWDQALAIR
WLKDNIAAFGGDPELMTLFGESAGGGSVSIHLVSPITRGLARRGIMQSGT
MNAPWSFMTAERATEIAKTLIDDCGCNSSLLTDAPSRVMSCMRSVEAKII
SVQQWNSYSGILGLPSAPTIDGIFLPKHPLDLLKEGDFQDTEILIGSNQD
EGTYFILYDFIDFFQKDGPSFLQRDKFLDIINTIFKNMTKIEREAIIFQY
TDWEHVMDGYLNQKMIGDVVGDYFFICPTNHFAQAFAERGKKVYYYFFTQ
RTSTSLWGEWMGVMHGDEIEYVFGHPLNMSLQFNARERDLSLRIMQAYSR
FALTGKPVPDDVNWPIYSKDQPQYYIFNAETSGTGRGPRATACAFWNDFL
PRLKARAEGELECETPSPAPTSMDDYNTPDEMTFNMTSSAMITAAN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSKMDTKQASTEPWKTAVLGAMFTMMVLSGKIEGRSFSQERQHEEMKES
SGHMHHSDPLIVETHSGHVRGISKTVLGREVHVFTGIPFAKPPIGPLRFR
KPVPVDPWHGVLDATALPNSCYQERYEYFPGFEGEEMWNPNTNLSEDCLY
LNIWVPHRLRIRHRANSEENKPRAKVPVLIWIYGGGYMSGTATLDVYDAD
MVAATSDVIVASMQYRVGAFGFLYLAQDLPRGSEEAPGNMGLWDQALAIR
WLKDNIAAFGGDPELMTLFGESAGGGSVSIHLVSPITRGLARRGIMQSGT
MNAPWSFMTAERATEIAKTLIDDCGCNSSLLTDAPSRVMSCMRSVEAKII
SVQQWNSYSGILGLPSAPTIDGIFLPKHPLDLLKEGDFQDTEILIGSNQD
EGTYFILYDFIDFFQKDGPSFLQRDKFLDIINTIFKNMTKIEREAIIFQY
TDWEHVMDGYLNQKMIGDVVGDYFFICPTNHFAQAFAERGKKVYYYFFTQ
RTSTSLWGEWMGVMHGDEIEYVFGHPLNMSLQFNARERDLSLRIMQAYSR
FALTGKPVPDDVNWPIYSKDQPQYYIFNAETSGTGRGPRATACAFWNDFL
PRLKARAEGELECETPSPAPTSMDDYNTPDEMTFNMTSSAMITAAN


References
    Title: Molecular characterization of two acetylcholinesterase genes from the brown planthopper, Nilaparvata lugens (Hemiptera: Delphacidae)
    Li BL, Chen W, Liu L, Zhang XC, Bao YY, Cheng JA, Zhu ZR, Zhang CX
    Ref: Pesticide Biochemistry and Physiology, 102:198, 2012 : PubMed

            

    Title: Molecular cloning and characterization of an acetylcholinesterase cDNA in the brown planthopper, Nilaparvata lugens
    Yang Z, Chen J, Chen Y, Jiang S
    Ref: J Insect Sci, 10:102, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer