Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nech7-c7yq54

Nectria haematococca (Fusarium solani subsp. pisi); Fusarium sp. Hydrolase_4 domain-containing protein

Comment
Other strains: Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi); Fusarium sp. AF-8


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Nectria haematococca
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium solani species complex: N E > Nectria haematococca: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : GG698898, XP_003052124, NKCI01000003
2 UniProt : C7YQ54, A0A428R572
2 UniProt : C7YQ54, A0A428R572
2 Interpro : C7YQ54, A0A428R572
2 Pfam : C7YQ54, A0A428R572
2 PIRSF : C7YQ54, A0A428R572
2 SUPERFAM : C7YQ54, A0A428R572
Sequence
Graphical view for this peptide sequence: nech7-c7yq54
Colored MSA for ABHD13-BEM46 (raw)
MASSNPPPSPSSTSYLEQTVSILTSVAGYMRLPALASTGIAAVLTSLLYF
KQKALIYPSHIPANSRSDVPKPSDFGIKNFEELYIPTDDGEKLSAFYIRG
PRGHKNSNVTILMFHGNAGNIGHRLPIARMIINYIGCNVFMLEYRGYGSS
TGEPDESGLNIDAQTGLNYLRQRAETRDHKLIVYGQSLGGAVSIKLVAKN
QDSGAITGLILENTFLSIRKLIPSVVPPAKYLTLLCHQVWPSESILPSIN
KVPTLFISGLQDEIVPPRHMKQLYEISTAPTKRWKPLPGGDHNSSVLEEG
YFEAMSDFIAEVTGDSPREKTRI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASSNPPPSPSSTSYLEQTVSILTSVAGYMRLPALASTGIAAVLTSLLYF
KQKALIYPSHIPANSRSDVPKPSDFGIKNFEELYIPTDDGEKLSAFYIRG
PRGHKNSNVTILMFHGNAGNIGHRLPIARMIINYIGCNVFMLEYRGYGSS
TGEPDESGLNIDAQTGLNYLRQRAETRDHKLIVYGQSLGGAVSIKLVAKN
QDSGAITGLILENTFLSIRKLIPSVVPPAKYLTLLCHQVWPSESILPSIN
KVPTLFISGLQDEIVPPRHMKQLYEISTAPTKRWKPLPGGDHNSSVLEEG
YFEAMSDFIAEVTGDSPREKTRI


Reference
    Title: The genome of Nectria haematococca: contribution of supernumerary chromosomes to gene expansion
    Coleman JJ, Rounsley SD, Rodriguez-Carres M, Kuo A, Wasmann CC, Grimwood J, Schmutz J, Taga M, White GJ and Vanetten HD <29 more author(s)>
    Ref: PLoS Genet, 5:e1000618, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer