Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-mpt51

Mycobacterium tuberculosis, Mycobacterium bovis, Secreted fibronectin-binding protein antigen protein fbpD MPT51/MPB51 antigen RV3803C MT3910 MB3833C

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|A85-Mycolyl-transferase
Block| X
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1R88: Structure of Mycobacterium tuberculosis MPT51 (FbpC1)
No kinetic





No Substrate
No inhibitor
>3 Genbank links 10 more: AL022076, AJ002150, D26486
>3 UniProt links 1 more: P9WQN6, P9WQN7, P0A4V7
1 Structure : 1R88
>3 UniProt links 2 more: Q9R5J6, P0A4V7, P9WQN6
>3 Interpro links 2 more: Q9R5J6, P0A4V7, P9WQN6
>3 Pfam links 2 more: Q9R5J6, P0A4V7, P9WQN6
>3 PIRSF links 2 more: Q9R5J6, P0A4V7, P9WQN6
>3 SUPERFAM links 2 more: Q9R5J6, P0A4V7, P9WQN6
Sequence
Graphical view for this peptide sequence: myctu-mpt51
Colored MSA for A85-Mycolyl-transferase (raw)
MKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDI
PVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGG
AYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYG
AMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWG
APQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAM
GNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDI
PVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGG
AYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYG
AMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWG
APQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAM
GNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR


References
6 more
    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            

    Title: Characterization of the gene encoding the MPB51, one of the major secreted protein antigens of Mycobacterium bovis BCG, and identification of the secreted protein closely related to the fibronectin binding 85 complex
    Ohara N, Kitaura H, Hotokezaka H, Nishiyama T, Wada N, Matsumoto S, Matsuo T, Naito M, Yamada T
    Ref: Scand J Immunol, 41:433, 1995 : PubMed

            

    Title: A family of cross-reacting proteins secreted by Mycobacterium tuberculosis
    Wiker HG, Nagai S, Harboe M, Ljungqvist L
    Ref: Scand J Immunol, 36:307, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer