Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-a85c

Mycobacterium tuberculosis, Mycobacterium bovis Antigen85c H37Rv FBPC fbpC or MPT45 or RV0129C or MTCI5.03C

Comment
Mycobacterium tuberculosis Antigen 85 enzymes (Ag85s) catalyze the transfer of mycolic acid (MA) from trehalose monomycolate to produce the mycolyl arabinogalactan (mAG) or trehalose dimycolate (TDM). These lipids define the protective mycomembrane of Mycobacteria. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains.


Relationship
Family|A85-Mycolyl-transferase
Block| X
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
18 structures (e.g. : 1DQY, 1DQZ, 1VA5... more)
No kinetic





2 substrates: Octylthioglucoside, alpha,alpha'-trehalose-6-mycolate
18 inhibitors (e.g. : Adamantyl-ebselen, Amino-ebselen, CyC-17... more)
>3 Genbank links 13 more: WP_003400908, BX842572, AE000516
>3 UniProt links 5 more: P0A4V5, P9WQN8, P9WQN9
2 Ncbi-pid : 1877254, 48828
>3 Structure links 15 more: 1DQZ, 1DQY, 7MYG
>3 UniProt links 25 more: P0A4V5, P9WQN8, P9WQN9
>3 Interpro links 25 more: P0A4V5, P9WQN8, P9WQN9
>3 Pfam links 25 more: P0A4V5, P9WQN8, P9WQN9
>3 PIRSF links 25 more: P0A4V5, P9WQN8, P9WQN9
>3 SUPERFAM links 25 more: P0A4V5, P9WQN8, P9WQN9
Sequence
Graphical view for this peptide sequence: myctu-a85c
Colored MSA for A85-Mycolyl-transferase (raw)
MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRP
GLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTP
AFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMP
AWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPS
EGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTR
IWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRP
GLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTP
AFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMP
AWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPS
EGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTR
IWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA


References
21 more
    Title: Mycolyltransferase from Mycobacterium tuberculosis in covalent complex with tetrahydrolipstatin provides insights into antigen 85 catalysis
    Goins CM, Dajnowicz S, Smith MD, Parks JM, Ronning DR
    Ref: Journal of Biological Chemistry, 293:3651, 2018 : PubMed

            

    Title: Characterization of Tetrahydrolipstatin and Stereoderivatives on the Inhibition of Essential Mycobacterium tuberculosis Lipid Esterases
    Goins CM, Sudasinghe TD, Liu X, Wang Y, O'Doherty GA, Ronning DR
    Ref: Biochemistry, 57:2383, 2018 : PubMed

            

    Title: Cyclipostins and cyclophostin analogs inhibit the antigen 85C from Mycobacterium tuberculosis both in vitro and in vivo
    Viljoen A, Richard M, Nguyen PC, Fourquet P, Camoin L, Paudal RR, Gnawali GR, Spilling CD, Cavalier JF and Kremer L <2 more author(s)>
    Ref: Journal of Biological Chemistry, 293:2755, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer