Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-Rv3569c

Mycobacterium tuberculosis and Mycobacterium bovis Rv3569c 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphD BPHD HSAD HsaD

Comment
(2-hydroxy-6-phenylhexa-2,4-dienoic acid hydrolase) recommended name 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains. Cholesterol metabolism contributes to the survival of M.tuberculosis in the host by helping the bacterial multiplication during earlier stages of infection and to the dissemination of the pathogen in the host.


Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
13 structures (e.g. : 2VF2, 2WUD, 2WUE... more)
No kinetic





4 substrates (e.g. : 4,9-DHSA, DSHA, HOPDA... more)
10 inhibitors (e.g. : 6OR-5JZ9, 6OT-5JZB, CyC-17... more)
>3 Genbank links 8 more: Z92774, BX248346, BX842583
>3 UniProt links 5 more: P9WNH4, P9WNH5, A1KPQ5
1 Ncbi-nid : 3261729
1 Ncbi-pid : 1877300
>3 Structure links 10 more: 7ZJT, 7ZM1, 7ZM2
3 UniProt : P9WNH4, P9WNH5, A5U8P4
3 Interpro : P9WNH4, P9WNH5, A5U8P4
3 Pfam : P9WNH4, P9WNH5, A5U8P4
3 PIRSF : P9WNH4, P9WNH5, A5U8P4
3 SUPERFAM : P9WNH4, P9WNH5, A5U8P4
Sequence
Graphical view for this peptide sequence: myctu-Rv3569c
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MTATEELTFESTSRFAEVDVDGPLKLHYHEAGVGNDQTVVLLHGGGPGAA
SWTNFSRNIAVLARHFHVLAVDQPGYGHSDKRAEHGQFNRYAAMALKGLF
DQLGLGRVPLVGNSLGGGTAVRFALDYPARAGRLVLMGPGGLSINLFAPD
PTEGVKRLSKFSVAPTRENLEAFLRVMVYDKNLITPELVDQRFALASTPE
SLTATRAMGKSFAGADFEAGMMWREVYRLRQPVLLIWGREDRVNPLDGAL
VALKTIPRAQLHVFGQCGHWVQVEKFDEFNKLTIEFLGGGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTATEELTFESTSRFAEVDVDGPLKLHYHEAGVGNDQTVVLLHGGGPGAA
SWTNFSRNIAVLARHFHVLAVDQPGYGHSDKRAEHGQFNRYAAMALKGLF
DQLGLGRVPLVGNSLGGGTAVRFALDYPARAGRLVLMGPGGLSINLFAPD
PTEGVKRLSKFSVAPTRENLEAFLRVMVYDKNLITPELVDQRFALASTPE
SLTATRAMGKSFAGADFEAGMMWREVYRLRQPVLLIWGREDRVNPLDGAL
VALKTIPRAQLHVFGQCGHWVQVEKFDEFNKLTIEFLGGGR


References
10 more
    Title: Direct capture, inhibition and crystal structure of HsaD (Rv3569c) from M. tuberculosis
    Barelier S, Avellan R, Gnawali GR, Fourquet P, Roig-Zamboni V, Poncin I, Point V, Bourne Y, Audebert S and Sulzenbacher G <4 more author(s)>
    Ref: Febs J, :, 2022 : PubMed

            

    Title: Cyclipostins and Cyclophostin analogs as promising compounds in the fight against tuberculosis
    Nguyen PC, Delorme V, Benarouche A, Martin BP, Paudel R, Gnawali GR, Madani A, Puppo R, Landry V and Canaan S <4 more author(s)>
    Ref: Sci Rep, 7:11751, 2017 : PubMed

            

    Title: Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach
    Ryan A, Polycarpou E, Lack NA, Evangelopoulos D, Sieg C, Halman A, Bhakta S, Eleftheriadou O, McHugh TD and Sim E <6 more author(s)>
    Ref: British Journal of Pharmacology, 174:2209, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer