Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-RV0045C

Mycobacterium tuberculosis; Mycobacterium bovis hypothetical protein rv0045c

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains. Classified Family XXIV in *Hitch and Clavel (2019)


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 3P2M, 6WYM, 6WYN
No kinetic





No Substrate
2 inhibitors: Lalistat-1, Lalistat-2
1 Genbank : NP_214559
>3 UniProt links 5 more: I6XU97, A1KEL3, C6DQQ6
3 Structure : 6WYM, 6WYN, 3P2M
3 UniProt : I6XU97, P71702, A5TYB6
3 Interpro : I6XU97, P71702, A5TYB6
3 Pfam : I6XU97, P71702, A5TYB6
3 PIRSF : I6XU97, P71702, A5TYB6
3 SUPERFAM : I6XU97, P71702, A5TYB6
Sequence
Graphical view for this peptide sequence: myctu-RV0045C
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MLSDDELTGLDEFALLAENAEQAGVNGPLPEVERVQAGAISALRWGGSAP
RVIFLHGGGQNAHTWDTVIVGLGEPALAVDLPGHGHSAWREDGNYSPQLN
SETLAPVLRELAPGAEFVVGMSLGGLTAIRLAAMAPDLVGELVLVDVTPS
ALQRHAELTAEQRGTVALMHGEREFPSFQAMLDLTIAAAPHRDVKSLRRG
VFHNSRRLDNGNWVWRYDAIRTFGDFAGLWDDVDALSAPITLVRGGSSGF
VTDQDTAELHRRATHFRGVHIVEKSGHSVQSDQPRALIEIVRGVLDTR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLSDDELTGLDEFALLAENAEQAGVNGPLPEVERVQAGAISALRWGGSAP
RVIFLHGGGQNAHTWDTVIVGLGEPALAVDLPGHGHSAWREDGNYSPQLN
SETLAPVLRELAPGAEFVVGMSLGGLTAIRLAAMAPDLVGELVLVDVTPS
ALQRHAELTAEQRGTVALMHGEREFPSFQAMLDLTIAAAPHRDVKSLRRG
VFHNSRRLDNGNWVWRYDAIRTFGDFAGLWDDVDALSAPITLVRGGSSGF
VTDQDTAELHRRATHFRGVHIVEKSGHSVQSDQPRALIEIVRGVLDTR


References
10 more
    Title: Transition metal cation inhibition of Mycobacterium tuberculosis esterase RV0045C
    Bowles IE, Pool EH, Lancaster BS, Lawson EK, Savas CP, Kartje ZJ, Severinac L, Cho DH, Macbeth MR and Hoops GC <1 more author(s)>
    Ref: Protein Science, :, 2021 : PubMed

            

    Title: Fluorogenic structure activity library pinpoints molecular variations in substrate specificity of structurally homologous esterases
    White A, Koelper A, Russell A, Larsen EM, Kim C, Lavis LD, Hoops GC, Johnson RJ
    Ref: Journal of Biological Chemistry, 293:13851, 2018 : PubMed

            

    Title: Crystal structure of a novel esterase Rv0045c from Mycobacterium tuberculosis
    Zheng X, Guo J, Xu L, Li H, Zhang D, Zhang K, Sun F, Wen T, Liu S, Pang H
    Ref: PLoS ONE, 6:e20506, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer