Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycmm-b2h1k1

Mycobacterium marinum (strain ATCC BAA-535 / M) Lipase/esterase LipN

Comment
Other strains: Mycobacterium marinum; Mycobacterium shottsii; Mycobacterium pseudoshottsii JCM 15466; Mycobacterium liflandii (strain 128FXT); Mycobacterium ulcerans (strain Agy99; subsp. shinshuense)


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Mycobacterium marinum M
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium marinum: N E > Mycobacterium marinum M: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: mycmm-b2h1k1
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTNSLPGETDLHPETVHATMSWLSRVQNTVTVVGAKVIPWVPDVAKRLIT
RGRSVIIDGNTLDPALQLMLSGMRVVGLDGLVIDDDLAASRAHMREAMLG
FPGPQIHVDVEELTLPGPAGDISARHYRPPGDAAAPLLVFYHGGGWALGD
LDTHDAVCRLTCRDAGIHVLAIDYRLSPEDRAPAAIDDAFAAFEWAHAHA
AELGALPGRVAVGGDSAGGNLAAVVSQLARDSGGPAPIFQWLIYPRTDFA
GRTRSASLFARGFLLTKRDIDWFHSQYLKGSGIEPTDPRVSPLRAESLAG
LAPALIAVAGFDPLRDEGENYATALRAAGTPVDLRAMGSLTHGFLNLFPL
GGGCAAATSELISALRAHLTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTNSLPGETDLHPETVHATMSWLSRVQNTVTVVGAKVIPWVPDVAKRLIT
RGRSVIIDGNTLDPALQLMLSGMRVVGLDGLVIDDDLAASRAHMREAMLG
FPGPQIHVDVEELTLPGPAGDISARHYRPPGDAAAPLLVFYHGGGWALGD
LDTHDAVCRLTCRDAGIHVLAIDYRLSPEDRAPAAIDDAFAAFEWAHAHA
AELGALPGRVAVGGDSAGGNLAAVVSQLARDSGGPAPIFQWLIYPRTDFA
GRTRSASLFARGFLLTKRDIDWFHSQYLKGSGIEPTDPRVSPLRAESLAG
LAPALIAVAGFDPLRDEGENYATALRAAGTPVDLRAMGSLTHGFLNLFPL
GGGCAAATSELISALRAHLTRV


References
    Title: Sequence and Structural Motifs Controlling the Broad Substrate Specificity of the Mycobacterial Hormone-Sensitive Lipase LipN
    Schemenauer DE, Pool EH, Raynor SN, Ruiz GP, Goehring LM, Koelper AJ, Wilson MA, Durand AJ, Jr., Kourtoglou EC and Johnson RJ <4 more author(s)>
    Ref: ACS Omega, 8:13252, 2023 : PubMed

            

    Title: Insights from the complete genome sequence of Mycobacterium marinum on the evolution of Mycobacterium tuberculosis
    Stinear TP, Seemann T, Harrison PF, Jenkin GA, Davies JK, Johnson PD, Abdellah Z, Arrowsmith C, Chillingworth T and Cole ST <21 more author(s)>
    Ref: Genome Res, 18:729, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer